Recombinant Full Length Xanthomonas Campestris Pv. Campestris Glucans Biosynthesis Glucosyltransferase H(Opgh) Protein, His-Tagged
Cat.No. : | RFL22302XF |
Product Overview : | Recombinant Full Length Xanthomonas campestris pv. campestris Glucans biosynthesis glucosyltransferase H(opgH) Protein (Q8P532) (1-645aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xanthomonas Campestris Pv. Campestris |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-645) |
Form : | Lyophilized powder |
AA Sequence : | MDGTVTLSPAPTDLPPVSSLDAGQPTLPPEAPLAMPEQSLREGSLQVRHQRTSPMGIGLR RFYLIGGTLTATAVAVWVMLSVLWPGGFSVLEGCLLGLFVLLFAWIAMSFASAVAGFITV VARAGRKLGIDPDAPLPSLHTRTALLMPTYNEDPRRLLAGLQAIYESVAETGQLEHFDFF VLSDTTREHIGRAEEQVYAELCDSVGGHGRIFYRRRADNAARKAGNVADWVRRFGGNYPQ MLILDADSVMTGDTIVRLVAGMEDNPDVGLIQTLPAVVNGQTLFARMQQFGGRVYGPIIA FGVAWWHGAESNYWGHNAIIRTQAFADHAGLPSLRGRKPFGGHVLSHDFVEAALMRRGGW AMHMVPYLQGSYEEGPPTLTDLLVRDRRWCQGNLQHAKVVGAKGLHWISRMHMMIGIGHY FTAPMWGMLMLVGIGIPLAGAGIDLAQGLPFSPARYWHGSSDGNAIWIFVCTMFVLLAPK LLGYIALLLNPRERRACGGAIRAALSILLETVLAALMAPVVMYLQSRGVFEVLAGKDSGW DAQVRDDGKLSWPALIRSYGGLSVFGLFMGTLAYLVSPSLAAWMAPVIVGMVVSIPVVAV TSLRRTGLALRRAGIFCIPEELDPPKVLVRASELRRAAALEPSLI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | opgH |
Synonyms | opgH; hrpM; XCC3515; Glucans biosynthesis glucosyltransferase H |
UniProt ID | Q8P532 |
◆ Native Proteins | ||
LOX-41 | Active Native Lactate Oxidase | +Inquiry |
Lectin-1758C | Active Native Canavalia ensiformis Concanavalin A Protein, Cy3 labeled | +Inquiry |
V8Protease-01S | Active Native Staph aureus V8 Protease, Tag Free | +Inquiry |
Hemoglobin Glutamer-01B | Native Bovine Hemoglobin Glutamer | +Inquiry |
Troponin I-12H | Native Human Troponin I protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
POLR2C-3036HCL | Recombinant Human POLR2C 293 Cell Lysate | +Inquiry |
Uterus-793D | Dog Uterus Membrane Lysate, Total Protein | +Inquiry |
GSTT1-312HCL | Recombinant Human GSTT1 lysate | +Inquiry |
QSOX1-2635HCL | Recombinant Human QSOX1 293 Cell Lysate | +Inquiry |
MC1R-4434HCL | Recombinant Human MC1R 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All opgH Products
Required fields are marked with *
My Review for All opgH Products
Required fields are marked with *
0
Inquiry Basket