Recombinant Full Length Vitis Vinifera Nad(P)H-Quinone Oxidoreductase Subunit 1, Chloroplastic(Ndha) Protein, His-Tagged
Cat.No. : | RFL35266VF |
Product Overview : | Recombinant Full Length Vitis vinifera NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic(ndhA) Protein (Q0ZIW3) (1-363aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Vitis vinifera |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-363) |
Form : | Lyophilized powder |
AA Sequence : | MIIDTPEVQDINSFSRLEYLKEVYGIIWMLVPIFTPVLGITIGVLAIVWLEREISAGIQQ RIGPEYAGPLGILQALADGTKLLFKENLLPSRGDTRLFSIGPSIAVISILLSYLIIPFGS NLVLSDLNIGVFLWIAISSIAPIGLLMSGYGSNNKYSFLGGLRAAAQSISYEIPLTLCVL SISLLSNSSSTVDIVEAQSKYGFWGWNLWRQPIGFIVFLISSLAECERLPFDLPEAEEEL VAGYQTEYSGIKFGLFYVASYLNLLVSSLFVTVLYLGGWDLSIPYIFVPEFFEINKAGEV FGTTIGIFITLAKTYLFLFIPITTRWTLPRLRMDQLLNLGWKFLLPISLGNLLLTTSSQL LSL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndhA |
Synonyms | ndhA; NAD(PH-quinone oxidoreductase subunit 1, chloroplastic; NAD(PH dehydrogenase subunit 1; NDH subunit 1; NADH-plastoquinone oxidoreductase subunit 1 |
UniProt ID | Q0ZIW3 |
◆ Recombinant Proteins | ||
RFL5556LF | Recombinant Full Length Lolium Perenne Photosystem Q(B) Protein Protein, His-Tagged | +Inquiry |
IFNA1-4335B | Recombinant Bovine IFNA1 protein, His&Myc-tagged | +Inquiry |
FKBP2-5906M | Recombinant Mouse FKBP2 Protein | +Inquiry |
CETN2-118H | Recombinant Human CETN2, His tagged | +Inquiry |
EMM5-2177S | Recombinant Streptococcus Pyogenes Serotype M5 EMM5 Protein (43-461 aa), His-SUMO-Myc-tagged | +Inquiry |
◆ Native Proteins | ||
MMP1-45H | Native Human MMP-1 | +Inquiry |
Troponin I-12H | Native Human Troponin I protein | +Inquiry |
Proteoglycans-53H | Native Human Proteoglycans | +Inquiry |
FGB-40B | Native Bovine Fibrinogen, FITC Labeled | +Inquiry |
Testosterone-01H | Native Human Testosterone | +Inquiry |
◆ Cell & Tissue Lysates | ||
STON1-1389HCL | Recombinant Human STON1 293 Cell Lysate | +Inquiry |
SOX17-1562HCL | Recombinant Human SOX17 293 Cell Lysate | +Inquiry |
CLUHP3-1096HCL | Recombinant Human CLUHP3 cell lysate | +Inquiry |
POU5F2-2998HCL | Recombinant Human POU5F2 293 Cell Lysate | +Inquiry |
SLC25A18-1779HCL | Recombinant Human SLC25A18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ndhA Products
Required fields are marked with *
My Review for All ndhA Products
Required fields are marked with *
0
Inquiry Basket