Recombinant Full Length Vibrio Harveyi Fumarate Reductase Subunit C(Frdc) Protein, His-Tagged
Cat.No. : | RFL3867VF |
Product Overview : | Recombinant Full Length Vibrio harveyi Fumarate reductase subunit C(frdC) Protein (A7MZ43) (1-127aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Vibrio campbellii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-127) |
Form : | Lyophilized powder |
AA Sequence : | MSNRKPYVREVKRTWWKNHPFYRFYMLREATVLPLILFTIFLTFGLGSLVKGPEAWQGWL EFMANPIVVAINIVALLGSLFHAQTFFSMMPQVMPIRLKGKPVDKKIIVLTQWAAVAFIS LIVLIVM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | frdC |
Synonyms | frdC; VIBHAR_00133; Fumarate reductase subunit C; Quinol-fumarate reductase subunit C; QFR subunit C |
UniProt ID | A7MZ43 |
◆ Native Proteins | ||
H3N2-01I | Active Native IAV H3N2 Protein | +Inquiry |
IgG-119S | Native Sheep Immunoglobulin G | +Inquiry |
Skin-008H | Human Skin Lysate, Total Protein | +Inquiry |
MMP8-1656H | Active Native Human MMP8 Protein | +Inquiry |
CKM-368P | Native Pig Creatine Kinase, Muscle | +Inquiry |
◆ Cell & Tissue Lysates | ||
Spike-1058HCL | Recombinant HCoV-EMC/2012 Spike cell lysate | +Inquiry |
NCR3-2652HCL | Recombinant Human NCR3 cell lysate | +Inquiry |
TPST2-833HCL | Recombinant Human TPST2 293 Cell Lysate | +Inquiry |
TMEM143-1000HCL | Recombinant Human TMEM143 293 Cell Lysate | +Inquiry |
UBXN6-722HCL | Recombinant Human UBXN6 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All frdC Products
Required fields are marked with *
My Review for All frdC Products
Required fields are marked with *
0
Inquiry Basket