Recombinant Full Length Vaucheria Litorea Atp-Dependent Zinc Metalloprotease Ftsh(Ftsh) Protein, His-Tagged
Cat.No. : | RFL14255VF |
Product Overview : | Recombinant Full Length Vaucheria litorea ATP-dependent zinc metalloprotease FtsH(ftsH) Protein (B7T1V0) (1-644aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Vaucheria litorea (Yellow-green alga) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-644) |
Form : | Lyophilized powder |
AA Sequence : | MKSWSVNKIIMLISLFLLEVIDSQIISNNIINNFNTKQNSNNIKMTYGRFLEYLDMGWIK KVDFYDNGRIAIIEASSPELGDRLQKIRVEIPVGDSPLIVKLRTAKVDFTAHSTINSKGI FTQLSNIFIPLIIIIGLIFLFRRSTNFMSGPGQLMSFRKARAKVQTEINTDVVFDDVAGI DEVKEEFEEVVTFLRKPQRFLSVGAKIPKGVILIGPPGTGKTLLAKAIAGEAGVPFISIS GSEFVEMFVGIGASRVRDLFKTAQQNAPCIVFIDEIDAVGRQRGAGIGGGNDEREQTLNQ ILTEMDGFKENTGIIVIAATNRVDVLDGALLRPGRFDRQVSINLPDIKGRLEILKVHAKN KKLDSNISLGLIAQRTPGFSGADLANLLNESAILTARRNKFAITMSEVNTAIDRLLAGLE GTSLTDTKNKRLIAYHEIGHAVIGTLLKYHDEVQKVTLIPRGQARGLTWFIPNDEQALIS RGQLVARIIGTLGGRAAEEVVFGSSEITTGASNDLQQITNLTRQMVTRLGMSTVGPISLD ANVEQVFIGRGIKNNNEFSASVANKIDDQVKIIIKHCYDQAVNIIKQNRFLIDQLVNTLI QEETISGNDFREQINNYTKLPKKLSTLSEKNNVNPKITESFVVF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ftsH |
Synonyms | ftsH; ATP-dependent zinc metalloprotease FtsH |
UniProt ID | B7T1V0 |
◆ Recombinant Proteins | ||
LYRM4-1777H | Recombinant Human LYRM4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MEI1-9718M | Recombinant Mouse MEI1 Protein | +Inquiry |
Wnt2-4631M | Recombinant Mouse Wnt2 protein, His-tagged | +Inquiry |
GOT2-3804M | Recombinant Mouse GOT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC25A22-2721H | Recombinant Human SLC25A22, GST-tagged | +Inquiry |
◆ Native Proteins | ||
APC-137 | Native Spirulina sp. Allophycocyanin protein | +Inquiry |
Lectin-1853U | Active Native Ulex Europaeus Agglutinin I Protein, Fluorescein labeled | +Inquiry |
SERPINF2-27145TH | Native Human SERPINF2 | +Inquiry |
AFP-1180H | Native Human Alpha-Fetoprotein | +Inquiry |
Lectin-1842S | Active Native Solanum Tuberosum Lectin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
FKBP5-6204HCL | Recombinant Human FKBP5 293 Cell Lysate | +Inquiry |
AKR1E2-51HCL | Recombinant Human AKR1E2 cell lysate | +Inquiry |
IL1RAP-2730HCL | Recombinant Human IL1RAP cell lysate | +Inquiry |
HAND1-5639HCL | Recombinant Human HAND1 293 Cell Lysate | +Inquiry |
ZNF593-40HCL | Recombinant Human ZNF593 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ftsH Products
Required fields are marked with *
My Review for All ftsH Products
Required fields are marked with *
0
Inquiry Basket