Recombinant Full Length Variola Virus Myristoylated Protein G9 (G9R, H9R, I10R) Protein, His-Tagged
Cat.No. : | RFL36237VF |
Product Overview : | Recombinant Full Length Variola virus Myristoylated protein G9 (G9R, H9R, I10R) Protein (P32998) (2-340aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | VARV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-340) |
Form : | Lyophilized powder |
AA Sequence : | GGGVSVELPKRDPPPGVPTDEMLLNVDKMHDVIAPAKLLEYVHIGPLAKDKEDKVKKRYP EFRLVNTGPGGLSALLRQSYNGTAPNCCHTFNRTHYWKKDGKISDKYEEGAVLESCWPDV HDTGKCDVNLFDWCQGDTFDRNICHQWIGSAFNRSDRTVEGQQSLINLYNKMQTLCSKDA SVPICESFLHHLRAHNTEDSKEMIDYILRQQSANFKQKYMRCSYPTRDKLEESLKYAEPR ECWDPECSNANVNFLLTRNYNNLGLCNIVRCNTSVNNLQMDKTSSLRLSCGLSNSDRFST VPVNRAKVVQHNIKHSFDLKLHLISLLSLLVIWILIVAI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | G9R |
UniProt ID | P32998 |
◆ Native Proteins | ||
Cry2Ab-37B | Native Bacillus thuringiensis Cry2Ab Protein | +Inquiry |
GPT-187H | Active Native Human Glutamate Pyruvate Transaminase | +Inquiry |
ACE-3047R | Native rabbit ACE | +Inquiry |
FABP1-509H | Native Human FABP1 | +Inquiry |
ORM1-8017R | Native Rat Serum Alpha-1-Acid GlycoProtein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NRG1-836CCL | Recombinant Canine NRG1 cell lysate | +Inquiry |
ARSJ-8674HCL | Recombinant Human ARSJ 293 Cell Lysate | +Inquiry |
USP22-464HCL | Recombinant Human USP22 293 Cell Lysate | +Inquiry |
SPANXA1-1545HCL | Recombinant Human SPANXA1 293 Cell Lysate | +Inquiry |
GTF2IRD2-764HCL | Recombinant Human GTF2IRD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All G9R Products
Required fields are marked with *
My Review for All G9R Products
Required fields are marked with *
0
Inquiry Basket