Recombinant Full Length Vanderwaltozyma Polyspora Spore Membrane Assembly Protein 2(Sma2) Protein, His-Tagged
Cat.No. : | RFL34822VF |
Product Overview : | Recombinant Full Length Vanderwaltozyma polyspora Spore membrane assembly protein 2(SMA2) Protein (A7TMB7) (1-362aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Vanderwaltozyma polyspora |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-362) |
Form : | Lyophilized powder |
AA Sequence : | MIFLKRFIVWTFLFIVTLIQLLLYLPDFSCISKNGGLPICTSQFNFAIVDSSHITHDFIT SIRELLRLLSYLTIDMGWSSGLPAPDAYNDENLVDTFHLNNIYKVNYFGYCKKNGKQKEY CTSNHSSGMDILALLVRDVGIQLGKLSSAYENNTEILGESLVFTYELSLSSLHTFIKGDR QRGNILPKIVTNQGNEQTDLEYSSSKAYDKGVSLAYGLMLFNEIMYFIHIFEITISVHCF LNVILFGFALVWGKKQILLPTLLKITSSLLLVFASISFSGNLLYLLLLKMLEPDPTGITT TGWEMLEVKAGSGFIITCIRVGIQWIFLPVAFITSNHYIQPKKQQTKIDELKSDDESTVK QV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SMA2 |
Synonyms | SMA2; Kpol_520p34; Spore membrane assembly protein 2 |
UniProt ID | A7TMB7 |
◆ Native Proteins | ||
Fibronectin-13R | Native Rat Fibronectin Protein | +Inquiry |
LHB-840 | Native Luteinizing Hormone, beta Subunit | +Inquiry |
IgG-349H | Native Horse Gamma Globulin Fraction | +Inquiry |
Lectin-1786G | Active Native Griffonia Simplicifolia Lectin I isolectin B4 Protein | +Inquiry |
Lecithin-08E | Native Egg Yolk Lecithin | +Inquiry |
◆ Cell & Tissue Lysates | ||
UROS-482HCL | Recombinant Human UROS 293 Cell Lysate | +Inquiry |
APOA1-1497MCL | Recombinant Mouse APOA1 cell lysate | +Inquiry |
THSD1-2377MCL | Recombinant Mouse THSD1 cell lysate | +Inquiry |
PDHB-1322HCL | Recombinant Human PDHB cell lysate | +Inquiry |
NFKBIL2-3846HCL | Recombinant Human NFKBIL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SMA2 Products
Required fields are marked with *
My Review for All SMA2 Products
Required fields are marked with *
0
Inquiry Basket