Recombinant Full Length Ustilago Maydis Palmitoyltransferase Pfa4(Pfa4) Protein, His-Tagged
Cat.No. : | RFL20081UF |
Product Overview : | Recombinant Full Length Ustilago maydis Palmitoyltransferase PFA4(PFA4) Protein (Q4PE27) (1-604aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ustilago maydis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-604) |
Form : | Lyophilized powder |
AA Sequence : | MTNQDPDDGAYPSSQSDDDGIEALAINRQSRPLLAYEDQAAGQSDAFTDRDIPASTAPLT GRRRTPLSWTEVIWVSLTLLLIAVLGYSSQLYVMLPYYEKTPSFSPQALAAVLVPFNLGL LAIYYNYWLCVTTDAGSVPAGWQPEWSALEPVASLAELEHLHLVAEEEPSLELKQAIYRP RYCKTCSAFKPPRSHHCKTCQRCVLRMDHHCPWLANCVGHFNHAHFIRFLFYVDVTCLYH LIMISCRVLDSFNSYTYWREPCARELVWLVVNYALCIPVILLVGIFSLYHFYCLAVNQTT IESWEKDRTATMIRRGRVRKVKYPYDLGLWRNVRQVLGASPLVWCLPGAGARMAGDGLKY PVANGLGKSSRAWGSFRSHKSRHWMLQTMLQDSHVALGERQQCTDSLTYSVDVHDQESYV DPELEASVMHRLRWENWHRQQARLRVPSARLKAGVRQSGALLSVSFQAGWTDIPIHESLD TVTDSVLHTDSGSQYRWPPKDPSRPHPSRRTWASSSSPFTYPERSNPILDPTLSTRFPHN SSPSSSDSHSSLHLPHPPSLLDPLPHHFDPPHDPDTQPVNCPKRVSVRRGSEGYEVRPHT PWSV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PFA4 |
Synonyms | PFA4; UMAG_11136; Palmitoyltransferase PFA4; Protein S-acyltransferase; PAT; Protein fatty acyltransferase 4 |
UniProt ID | Q4PE27 |
◆ Recombinant Proteins | ||
ENSA-2108R | Recombinant Rat ENSA Protein | +Inquiry |
SLC35A4-5514R | Recombinant Rat SLC35A4 Protein | +Inquiry |
RFL25165AF | Recombinant Full Length Arabidopsis Thaliana Casp-Like Protein At4G20390(At4G20390) Protein, His-Tagged | +Inquiry |
ERBB3-1178R | Active Recombinant Rhesus ERBB3 protein, hFc-tagged | +Inquiry |
LY6H-2599R | Recombinant Rhesus monkey LY6H Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
OVAL-140C | Native Chicken ovalbumin | +Inquiry |
C3b-03M | Native Monkey C3b Protein | +Inquiry |
LDH4-224H | Active Native Human Lactate Dehydrogenase 4 | +Inquiry |
Thrombin-25H | Active Native Human β-thrombin | +Inquiry |
Lectin-1781G | Active Native Griffonia Simplicifolia Lectin I Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZAP70-1948HCL | Recombinant Human ZAP70 cell lysate | +Inquiry |
IMMT-5216HCL | Recombinant Human IMMT 293 Cell Lysate | +Inquiry |
A4GALT-9163HCL | Recombinant Human A4GALT 293 Cell Lysate | +Inquiry |
MLPH-4290HCL | Recombinant Human MLPH 293 Cell Lysate | +Inquiry |
ESYT1-6535HCL | Recombinant Human ESYT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PFA4 Products
Required fields are marked with *
My Review for All PFA4 Products
Required fields are marked with *
0
Inquiry Basket