Recombinant Full Length Upf0721 Transmembrane Protein Yfca(Yfca) Protein, His-Tagged
Cat.No. : | RFL11275EF |
Product Overview : | Recombinant Full Length UPF0721 transmembrane protein yfcA(yfcA) Protein (P0AD32) (1-269aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-269) |
Form : | Lyophilized powder |
AA Sequence : | METFNSLFMVSPLLLGVLFFVAMLAGFIDSIAGGGGLLTIPALMAAGMSPANALATNKLQ ACGGSISATIYFIRRKVVSLSDQKLNIAMTFVGSMSGALLVQYVQADVLRQILPILVICI GLYFLLMPKLGEEDRQRRMYGLPFALIAGGCVGFYDGFFGPAAGSFYALAFVTLCGFNLA KATAHAKLLNATSNIGGLLLFILGGKVIWATGFVMLVGQFLGARMGSRLVLSKGQKLIRP MIVIVSAVMSAKLLYDSHGQEILHWLGMN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yfcA |
Synonyms | yfcA; Z3590; ECs3211; Probable membrane transporter protein YfcA |
UniProt ID | P0AD32 |
◆ Recombinant Proteins | ||
NDUFB8-2805R | Recombinant Rhesus Macaque NDUFB8 Protein, His (Fc)-Avi-tagged | +Inquiry |
PCK1-3961R | Recombinant Rat PCK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PDPK1-4825H | Recombinant Human PDPK1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
IL7R-6306Z | Recombinant Zebrafish IL7R | +Inquiry |
DNAJC17-4641C | Recombinant Chicken DNAJC17 | +Inquiry |
◆ Native Proteins | ||
MARCKS-12B | Native Bovine MARCKS protein | +Inquiry |
CTSD-26411TH | Active Native Human Cathepsin D protein | +Inquiry |
F10-26946TH | Native Human F10 | +Inquiry |
CTSH-360H | Native Human Eosinophil Peroxidase | +Inquiry |
C3-08R | Native Rat C3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
F11R-2127MCL | Recombinant Mouse F11R cell lysate | +Inquiry |
WRAP53-283HCL | Recombinant Human WRAP53 293 Cell Lysate | +Inquiry |
RBMS1-2463HCL | Recombinant Human RBMS1 293 Cell Lysate | +Inquiry |
RABGGTA-2574HCL | Recombinant Human RABGGTA 293 Cell Lysate | +Inquiry |
ZNF446-2029HCL | Recombinant Human ZNF446 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yfcA Products
Required fields are marked with *
My Review for All yfcA Products
Required fields are marked with *
0
Inquiry Basket