Recombinant Full Length Upf0603 Protein Rv2345/Mt2410 (Rv2345, Mt2410) Protein, His-Tagged
Cat.No. : | RFL17478HF |
Product Overview : | Recombinant Full Length UPF0603 protein Rv2345/MT2410 (Rv2345, MT2410) Protein (P95241) (27-660aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (27-660) |
Form : | Lyophilized powder |
AA Sequence : | QPPFRLSNYVTDNAGVLTSSGRTAVTAAVDRLYADRRIRLWVVYVENFSGQSALNWAQRT TRTSELGNYDALLAVATTGREYAFLVPSAMPGVSEGQVDNVRRYQIEPALHDGDYSGAAV AAANGLNRSPSSSSRVVLLVTVGIIVIVVAVLLVVMRHRNRRRRADELAAARRVDPTNVM ALAAVPLQALDDLSRSMVVDVDNAVRTSTNELALAIEEFGERRTAPFTQAVNNAKAALSQ AFTVRQQLDDNTPETPAQRRELLTRVIVSAAHADRELASQTEAFEKLRDLVINAPARLDL LTQQYVELTTRIGPTQQRLAELHTEFDAAAMTSIAGNVTTATERLAFADRNISAARDLAD QAVSGRQAGLVDAVRAAESALGQARALLDAVDSAATDIRHAVASLPAVVADIQTGIKRAN QHLQQAQQPQTGRTGDLIAARDAAARALDRARGAADPLTAFDQLTKVDADLDRLLATLAE EQATADRLNRSLEQALFTAESRVRAVSEYIDTRRGSIGPEARTRLAEAKRQLEAAHDRKS SNPTEAIAYANAASTLAAHAQSLANADVQSAQRAYTRRGGNNAGAILGGIIIGDLLSGGT RGGLGGWIPTSFGGSSNAPGSSPDGGFLGGGGRF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | UPF0603 protein Rv2345/MT2410 (Rv2345, MT2410) |
UniProt ID | P95241 |
◆ Native Proteins | ||
LukAB-733S | Native S. aureus LukA-LukB heterodimer Protein | +Inquiry |
Acylase-3P | Active Native Porcine Acylase | +Inquiry |
RNase-43B | Active Native Bovine Ribonuclease | +Inquiry |
Lectin-1751A | Active Native Aleuria Aurantia Lectin Protein, Agarose bound | +Inquiry |
SERPINA1-P035H | Native Human alpha-1 proteinase inhibitor therapeutic protein (Aralast, Aralast NP, Glassia, Prolastin, Prolastin-C, Zemaira) | +Inquiry |
◆ Cell & Tissue Lysates | ||
LUZP1-4605HCL | Recombinant Human LUZP1 293 Cell Lysate | +Inquiry |
CLEC2B-7452HCL | Recombinant Human CLEC2B 293 Cell Lysate | +Inquiry |
TSPAN14-712HCL | Recombinant Human TSPAN14 293 Cell Lysate | +Inquiry |
VAX1-421HCL | Recombinant Human VAX1 293 Cell Lysate | +Inquiry |
LGALS12-4769HCL | Recombinant Human LGALS12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UPF0603 protein Rv2345/MT2410 (Rv2345, MT2410) Products
Required fields are marked with *
My Review for All UPF0603 protein Rv2345/MT2410 (Rv2345, MT2410) Products
Required fields are marked with *
0
Inquiry Basket