Recombinant Full Length Upf0392 Protein R07B7.12(R07B7.12) Protein, His-Tagged
Cat.No. : | RFL8675CF |
Product Overview : | Recombinant Full Length UPF0392 protein R07B7.12(R07B7.12) Protein (Q21802) (1-550aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-550) |
Form : | Lyophilized powder |
AA Sequence : | MGNFSFTMFQILNLKMNLSLPYCNRSTGRICSKIRLYHRSFRSNPSLQMCFIIVFLLFIF SLIMFMKLNQNSYSGKEILGYLYETAIDQLTYNHTHAFITSAYYYRNSKSLGENAVAMIV AMSQRTFKHLENHEITIVGSRGYQNLKTKASITVETAEQMSCEYVMALIQGITLEIPQKL EIESAGTRVQIPFREPRKNSHSPVIICISPQFVAEKWQLFLMNIHVIRRYGGHMHIYITS MVEKLFNVLKIYEDMEALTIDYWIRMKLKKTSSPVADIMKNVEWRHQAGAQTDCLLQYKE VAEFIAFFDIDDILVPNFSHNYHQEFSSHFNAYPSYHSIFYGKRDVFVEKISSIEDFSFR HLFSNMKIQEETGYGKSIVNPLKYNSTWIHHSMKLPRNKMLKIMNTEIIHIKNILDSELN KDAPIHLPIIYGTETESVIREMDLKTLDFDFQTVYQNPIYREAALKMIDYNFYTPIVFNC YNESFYHPYFVEKKDFSQICPNADNCQLPQREDIKCIHSDGEYVSGPEMYPITFHYAVHP FWSNDIGCYQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | R07B7.12 |
Synonyms | R07B7.12; Glycosyltransferase family 92 protein R07B7.12 |
UniProt ID | Q21802 |
◆ Recombinant Proteins | ||
CLIC2-1449R | Recombinant Rat CLIC2 Protein | +Inquiry |
Cd93-1062M | Active Recombinant Mouse Cd93 Protein, Fc Chimera | +Inquiry |
Csf3-2014M | Recombinant Mouse Csf3 Protein, His (Fc)-Avi-tagged | +Inquiry |
NELFB-4504H | Recombinant Human NELFB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SLC35D1-4092R | Recombinant Rhesus Macaque SLC35D1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
COL2A1-1648H | Native Human COL2A1 Protein | +Inquiry |
Pectin-008A | Native Apple or Citrus fruits Pectin | +Inquiry |
CGB-359H | Native Human Chorionic Gonadotropin, Beta Polypeptide | +Inquiry |
CTSG-8070H | Native Human Neutrophil Cathepsin G Biotinylated | +Inquiry |
Collagen type I & III-185 | Native Porcine Collagen type I & III Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACSM1-9072HCL | Recombinant Human ACSM1 293 Cell Lysate | +Inquiry |
NAA50-3991HCL | Recombinant Human NAA50 293 Cell Lysate | +Inquiry |
YBEY-8099HCL | Recombinant Human C21orf57 293 Cell Lysate | +Inquiry |
PIK3R1-3185HCL | Recombinant Human PIK3R1 293 Cell Lysate | +Inquiry |
ERC1-1024HCL | Recombinant Human ERC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All R07B7.12 Products
Required fields are marked with *
My Review for All R07B7.12 Products
Required fields are marked with *
0
Inquiry Basket