Recombinant Full Length Upf0392 Protein C35A5.5(C35A5.5) Protein, His-Tagged
Cat.No. : | RFL17981CF |
Product Overview : | Recombinant Full Length UPF0392 protein C35A5.5(C35A5.5) Protein (Q18473) (1-520aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-520) |
Form : | Lyophilized powder |
AA Sequence : | MTKIKRQINNFDFRRIKILLKKWNVVIYFVLILICFYFIIPIYFPNNDKMNLWLSSIKYY LTYPIYNESLTKTDAYIINTYYYPKSSSLGENAIGMILLMNRNTQRDMTKYRMKLIASNS SHQSVIVTPKFLEESYSSCPYINMVAMVNTLPNLNKLEIFDGERKMEIPFQMGKTTAPAS VIICISPQFVAEQWQLFVAHAHVARKFGGHLHMYVTSIIDTFFDLVQEYERLGYVTIDYW MRLKLANSSVDSVEPNLHSELRNQAGAQSDCLYQYKEAAAFITFFDLDDIFIPRGYDSYF DEFSALYELHPNILTFQYTKRETMVYNKAKIEDINFEELFGHTWFVNEEDYGKVMTKPGN LNSMWIHESWNIPTNRHHVSKSNYIIHMQKPVDPDGTDPVSYRMSNFEMLESMQLNASTL IPIQDDLERVLKSSNISMTAEDLPNKTYYFPIIYRCYYEKFYKKPKKDSCPNGEGCLIPQ RTGTNCIHSDADFKSGPEMWPITYHYHVNSKWSRTKGCHA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | C35A5.5 |
Synonyms | C35A5.5; Glycosyltransferase family 92 protein C35A5.5 |
UniProt ID | Q18473 |
◆ Recombinant Proteins | ||
FTSJ1-1759R | Recombinant Rhesus monkey FTSJ1 Protein, His-tagged | +Inquiry |
WT1-18590M | Recombinant Mouse WT1 Protein | +Inquiry |
VNN1-3668H | Recombinant Human VNN1, His-tagged | +Inquiry |
ROD1-2355H | Recombinant Human ROD1, His-tagged | +Inquiry |
MAA-1580B | Recombinant Bacillus subtilis MAA protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
VTN-2H | Native Human monomeric vitronectin, Biotin labeled | +Inquiry |
Collagen Type I & III-05C | Native Canine Collagen Type I and III Protein | +Inquiry |
CPD A-036H | Active Native Human Pancreatic Carboxypeptidase A | +Inquiry |
Cp-674M | Native Mouse Ceruloplasmin | +Inquiry |
HPX-84R | Native Rat Hemopexin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD2-1372RCL | Recombinant Rat CD2 cell lysate | +Inquiry |
GNAI3-5869HCL | Recombinant Human GNAI3 293 Cell Lysate | +Inquiry |
SWAP70-1325HCL | Recombinant Human SWAP70 293 Cell Lysate | +Inquiry |
C10orf57-8363HCL | Recombinant Human C10orf57 293 Cell Lysate | +Inquiry |
HSPA12B-5359HCL | Recombinant Human HSPA12B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All C35A5.5 Products
Required fields are marked with *
My Review for All C35A5.5 Products
Required fields are marked with *
0
Inquiry Basket