Recombinant Full Length Upf0353 Protein Ml1808(Ml1808) Protein, His-Tagged
Cat.No. : | RFL22079MF |
Product Overview : | Recombinant Full Length UPF0353 protein ML1808(ML1808) Protein (Q9CBL9) (1-335aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium leprae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-335) |
Form : | Lyophilized powder |
AA Sequence : | MTLPLLGPMSLSGFEHSWFFLFIFIVFGLAAFYVMMQVARQRRMLRFANMELLESVAPNR PVQWRHVPAILLMLALLLFTIAMAGPTNDVRIPRNRAVVMLVIDVSQSMRATDVEPNRMA AAQEAAKQFAGELTPGINLGLIAYAGTATVLVSPTTNRYATKNALDKLQFADRTATGEAI FTALQAIATVGAVIGGGEMPPPARIVLFSDGKETMPTNPDNPKGAYTAARTAKDQGVPIS TISFGTVYGFVEINGQRQPVPVDDETMKKVAQLSGGNSYNAATLAELKAVYASLQQQIGY ETIKGDASAGWLRLGVLVLALAALTALLINRRLPT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ML1808 |
Synonyms | ML1808; UPF0353 protein ML1808 |
UniProt ID | Q9CBL9 |
◆ Recombinant Proteins | ||
RFL28006BF | Recombinant Full Length Bovine Integral Membrane Protein Gpr137(Gpr137) Protein, His-Tagged | +Inquiry |
NI36-RS04720-1128S | Recombinant Staphylococcus aureus (strain: MS4, nat-host: Homo sapiens) NI36_RS04720 protein, His-tagged | +Inquiry |
BICD1-217H | Recombinant Human BICD1 Protein, GST-tagged | +Inquiry |
IL24-586H | Active Recombinant Human IL24, HIgG1 Fc-tagged | +Inquiry |
TNFSF13B-136C | Recombinant Cynomolgus TNFSF13B, Fc tagged | +Inquiry |
◆ Native Proteins | ||
FSH-185H | Active Native Human Follicle Stimulating Hormone(FSH) protein | +Inquiry |
Lectin-1736C | Active Native Canavalia ensiformis Concanavalin A Protein, Rhodamine labeled | +Inquiry |
Prostate-016H | Human Prostate Lysate, Total Protein | +Inquiry |
MB-8227H | Native Human Heart Myoglobin | +Inquiry |
ALPL-5324H | Active Native Human Alkaline Phosphatase | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSN-4110HCL | Recombinant Human MSN 293 Cell Lysate | +Inquiry |
POLR3D-3025HCL | Recombinant Human POLR3D 293 Cell Lysate | +Inquiry |
DNAJC17-6876HCL | Recombinant Human DNAJC17 293 Cell Lysate | +Inquiry |
TUBB3-648HCL | Recombinant Human TUBB3 293 Cell Lysate | +Inquiry |
WDR31-352HCL | Recombinant Human WDR31 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ML1808 Products
Required fields are marked with *
My Review for All ML1808 Products
Required fields are marked with *
0
Inquiry Basket