Recombinant Full Length Upf0353 Protein Mb1517 (Mb1517) Protein, His-Tagged
Cat.No. : | RFL18456MF |
Product Overview : | Recombinant Full Length UPF0353 protein Mb1517 (Mb1517) Protein (P64856) (1-335aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium Bovis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-335) |
Form : | Lyophilized powder |
AA Sequence : | MTLPLLGPMTLSGFAHSWFFLFLFVVAGLVALYILMQLARQRRMLRFANMELLESVAPKR PSRWRHVPAILLVLSLLLFTIAMAGPTHDVRIPRNRAVVMLVIDVSQSMRATDVEPSRMV AAQEAAKQFADELTPGINLGLIAYAGTATVLVSPTTNREATKNALDKLQFADRTATGEAI FTALQAIATVGAVIGGGDTPPPARIVLFSDGKETMPTNPDNPKGAYTAARTAKDQGVPIS TISFGTPYGFVEINDQRQPVPVDDETMKKVAQLSGGNSYNAATLAELRAVYSSLQQQIGY ETIKGDASVGWLRLGALALALAALAALLINRRLPT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BQ2027_MB1517 |
Synonyms | BQ2027_MB1517; UPF0353 protein Mb1517 |
UniProt ID | P64856 |
◆ Recombinant Proteins | ||
Epor-600M | Recombinant Mouse Epor protein, His-tagged | +Inquiry |
IFIH1-0072H | Recombinant Human IFIH1 Protein, Tag Free | +Inquiry |
RFL17500SF | Recombinant Full Length Staphylococcus Aureus Heme Sensor Protein Hsss(Hsss) Protein, His-Tagged | +Inquiry |
POU5F1-3631H | Recombinant Full Length Human POU Class 5 Homeobox 1/POU5F1 Protein | +Inquiry |
CYP26B1-01H | Recombinant Human CYP26B1 Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
PTA-23B | Active Native Bacillus stearothermophilus Phosphotransacetylase | +Inquiry |
Lecithin-09E | Native Egg Yolk Lecithin | +Inquiry |
dsbA-8328E | Native E.coli dsbA | +Inquiry |
BGLAP-286B | Native Bovine Osteocalcin | +Inquiry |
Thrombin-12S | Native Atlantic salmon Thrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFI35-5293HCL | Recombinant Human IFI35 293 Cell Lysate | +Inquiry |
PILRA-002HCL | Recombinant Human PILRA cell lysate | +Inquiry |
UBA2-606HCL | Recombinant Human UBA2 293 Cell Lysate | +Inquiry |
TMEM167B-993HCL | Recombinant Human TMEM167B 293 Cell Lysate | +Inquiry |
IL2RA-2907HCL | Recombinant Human IL2RA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BQ2027_MB1517 Products
Required fields are marked with *
My Review for All BQ2027_MB1517 Products
Required fields are marked with *
0
Inquiry Basket