Recombinant Full Length Upf0283 Membrane Protein Yptb2265(Yptb2265) Protein, His-Tagged
Cat.No. : | RFL20409YF |
Product Overview : | Recombinant Full Length UPF0283 membrane protein YPTB2265(YPTB2265) Protein (Q66A67) (1-353aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yersinia Pseudotuberculosis Serotype I |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-353) |
Form : | Lyophilized powder |
AA Sequence : | MSEPLKPRIDFEQPLQSLDEPVLKSAQAFDEQAAEKFYPAAPELDAEDEEGRVEGLVNAA LKPKRSLWRKMVTAGMVILGASVIAQSVQWVNQAWQQQDWIALGATTAGGLIILAGVGSV VTEWRRLYHLRQRAEERDIARALLVSHGVGQGRVFCEKLARQAGLDQGHPALQRWQASLH ETHNDREVVELYAKLVQPALDNQARAEISRYAAESALMIAVSPLALVDMAFIAWRNIRLI NRIAALYGIELGYFSRIRLFRLVLLNIAFAGASELVREVGMDWLSQDLAARLSARAAQGI GAGLLTARLGIKAMELCRPLPWLEGDKPKLGDFRRQLMNQLKNTLPKKDKTAH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | YPTB2265 |
Synonyms | YPTB2265; UPF0283 membrane protein YPTB2265 |
UniProt ID | Q66A67 |
◆ Recombinant Proteins | ||
NUC-045 | Recombinant Human Mononucleosomes (H3.3K4M), Biotinylated | +Inquiry |
CES2-3263HF | Recombinant Full Length Human CES2 Protein, GST-tagged | +Inquiry |
GDA-16H | Active Recombinant Human GDA protein, His-tagged (Bioactivity Validated) | +Inquiry |
AMY1-1612M | Recombinant Mouse AMY1 Protein | +Inquiry |
SEMA6E-7853Z | Recombinant Zebrafish SEMA6E | +Inquiry |
◆ Native Proteins | ||
C8-103H | Native Human C8 Protein | +Inquiry |
PLG-54H | Native Human glu-Plasminogen | +Inquiry |
Lectin-1752A | Active Native Aleuria Aurantia Lectin Protein, Biotinylated | +Inquiry |
Ckmm-167R | Native Rat Creatine Kinase MM | +Inquiry |
CKMM-166M | Native Mouse Creatine Kinase MM | +Inquiry |
◆ Cell & Tissue Lysates | ||
SMYD4-1644HCL | Recombinant Human SMYD4 293 Cell Lysate | +Inquiry |
ANXA11-8836HCL | Recombinant Human ANXA11 293 Cell Lysate | +Inquiry |
LRCH1-392HCL | Recombinant Human LRCH1 lysate | +Inquiry |
CCNI-7704HCL | Recombinant Human CCNI 293 Cell Lysate | +Inquiry |
TAS2R13-651HCL | Recombinant Human TAS2R13 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YPTB2265 Products
Required fields are marked with *
My Review for All YPTB2265 Products
Required fields are marked with *
0
Inquiry Basket