Recombinant Full Length Upf0060 Membrane Protein Ynfa(Ynfa) Protein, His-Tagged
Cat.No. : | RFL28370EF |
Product Overview : | Recombinant Full Length UPF0060 membrane protein YnfA(ynfA) Protein (Q8X7A6) (1-108aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-108) |
Form : | Lyophilized powder |
AA Sequence : | MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHPAASGRVY AAYGGVYVCTALMWLRVVDGVKLTLYDWTGPLIALCGMLIIVVGWGRT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ynfA |
Synonyms | ynfA; Z2569; ECs2288; UPF0060 membrane protein YnfA |
UniProt ID | Q8X7A6 |
◆ Recombinant Proteins | ||
UAF1-01H | Active Recombinant Human UAF1 Protein, His-Tagged | +Inquiry |
BCR-0218H | Recombinant Human BCR Protein (174-331), His-tagged | +Inquiry |
RFL34354HF | Recombinant Full Length Human Tripartite Motif-Containing Protein 59(Trim59) Protein, His-Tagged | +Inquiry |
GALP-2791H | Recombinant Human GALP Protein (Arg29-Ser116), N-GST tagged | +Inquiry |
SERPINB1-90H | Recombinant Human SERPINB1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen-316B | Native Bovine Collagen Type II | +Inquiry |
LRP1-87H | Native Human Lipoproteins | +Inquiry |
GH1-8147H | Native Growth Hormone (GH) | +Inquiry |
PeptideD-724E | Native Ebola virus Delta Peptide | +Inquiry |
Immunoglobulin-5264B | Native Bovine Immunoglobulin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Artery-35R | Rhesus monkey Blood Vessel: Artery Lysate | +Inquiry |
HIST1H4J-5520HCL | Recombinant Human HIST1H4J 293 Cell Lysate | +Inquiry |
SAMM50-2071HCL | Recombinant Human SAMM50 293 Cell Lysate | +Inquiry |
NDUFA4-3919HCL | Recombinant Human NDUFA4 293 Cell Lysate | +Inquiry |
SSR4-1457HCL | Recombinant Human SSR4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ynfA Products
Required fields are marked with *
My Review for All ynfA Products
Required fields are marked with *
0
Inquiry Basket