Recombinant Full Length Upf0053 Protein Rv1842C/Mt1890(Rv1842C, Mt1890) Protein, His-Tagged
Cat.No. : | RFL36320HF |
Product Overview : | Recombinant Full Length UPF0053 protein Rv1842c/MT1890(Rv1842c, MT1890) Protein (Q50592) (1-455aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-455) |
Form : | Lyophilized powder |
AA Sequence : | MNLTDTVATILAILALTAGTGVFVAAEFSLTALDRSTVEANARGGTSRDRFIQRAHHRLS FQLSGAQLGISITTLATGYLTEPLVAELPHPGLVAVGMSDRVADGLITFFALVIVTSLSM VFGELVPKYLAVARPLRTARSVVAGQVLFSLLLTPAIRLTNGAANWIVRRLGIEPAEELR SARTPQELVSLVRSSARSGALDDATAWLMRRSLQFGALTAEELMTPRSKIVALQTDDTIA DLVAAAAASGFSRFPVVEGDLDATVGIVHVKQVFEVPPGDRAHTLLTTVAEPVAVVPSTL DGDAVMAQVRASALQTAMVVDEYGGTAGMVTLEDLIEEIVGDVRDEHDDATPDVVAAGNG WRVSGLLRIDEVASATGYRAPDGPYETIGGLVLRELGHIPVAGETVELTALDQDGLPDDS MRWLATVIQMDGRRIDLLELIKMGGHADPGSGRGR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | UPF0053 protein Rv1842c/MT1890(Rv1842c, MT1890) |
UniProt ID | Q50592 |
◆ Recombinant Proteins | ||
SPAG16-704C | Recombinant Cynomolgus Monkey SPAG16 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL9704BF | Recombinant Full Length Bovine Tetraspanin-13(Tspan13) Protein, His-Tagged | +Inquiry |
PTPRZ1-3709R | Recombinant Rhesus monkey PTPRZ1 Protein, His-tagged | +Inquiry |
ANXA2-4987H | Recombinant Human ANXA2 protein(2-339aa), His-Myc-tagged | +Inquiry |
TGS1-9172M | Recombinant Mouse TGS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Skeletal Muscles-012H | Human Skeletal Muscles Lysate, Total Protein | +Inquiry |
CST3-26152TH | Native Human CST3 | +Inquiry |
ATF-180M | Native Mouse Apotransferrin | +Inquiry |
Alb-7992M | Native Mouse Serum Albumin | +Inquiry |
B2M-13H | Native Human B2M | +Inquiry |
◆ Cell & Tissue Lysates | ||
Thymus-522H | Human Thymus Cytoplasmic Lysate | +Inquiry |
SNRPF-1612HCL | Recombinant Human SNRPF 293 Cell Lysate | +Inquiry |
FPR2-665HCL | Recombinant Human FPR2 cell lysate | +Inquiry |
P2RX3-3500HCL | Recombinant Human P2RX3 293 Cell Lysate | +Inquiry |
CRLF2-7275HCL | Recombinant Human CRLF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UPF0053 protein Rv1842c/MT1890(Rv1842c, MT1890) Products
Required fields are marked with *
My Review for All UPF0053 protein Rv1842c/MT1890(Rv1842c, MT1890) Products
Required fields are marked with *
0
Inquiry Basket