Recombinant Full Length Upf0053 Inner Membrane Protein Ytfl(Ytfl) Protein, His-Tagged
Cat.No. : | RFL32308EF |
Product Overview : | Recombinant Full Length UPF0053 inner membrane protein ytfL(ytfL) Protein (P0AE47) (1-447aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-447) |
Form : | Lyophilized powder |
AA Sequence : | MLNSILVILCLIAVSAFFSMSEISLAASRKIKLKLLADEGNINAQRVLNMQENPGMFFTV VQIGLNAVAILGGIVGDAAFSPAFHSLFSRYMSAELSEQLSFILSFSLVTGMFILFADLT PKRIGMIAPEAVALRIINPMRFCLYVCTPLVWFFNGLANIIFRIFKLPMVRKDDITSDDI YAVVEAGALAGVLRKQEHELIENVFELESRTVPSSMTPRENVIWFDLHEDEQSLKNKVAE HPHSKFLVCNEDIDHIIGYVDSKDLLNRVLANQSLALNSGVQIRNTLIVPDTLTLSEALE SFKTAGEDFAVIMNEYALVVGIITLNDVMTTLMGDLVGQGLEEQIVARDENSWLIDGGTP IDDVMRVLDIDEFPQSGNYETIGGFMMFMLRKIPKRTDSVKFAGYKFEVVDIDNYRIDQL LVTRIDSKATALSPKLPDAKDKEESVA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ytfL |
Synonyms | paeA; ytfL; Z5829; ECs5196; Polyamine export protein |
UniProt ID | P0AE47 |
◆ Recombinant Proteins | ||
LAMB3-8936M | Recombinant Mouse LAMB3 Protein | +Inquiry |
CASP4-2928HF | Recombinant Full Length Human CASP4 Protein, GST-tagged | +Inquiry |
AMD1-516H | Recombinant Human AMD1 protein, GST-tagged | +Inquiry |
RFL27645DF | Recombinant Full Length Debaryomyces Hansenii Mitochondrial Import Inner Membrane Translocase Subunit Tim50(Tim50) Protein, His-Tagged | +Inquiry |
NUDT15-892HFL | Recombinant Full Length Human NUDT15 Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
PNLIP-8205H | Native Human Pancreas Lipase | +Inquiry |
APCS-8258H | Native Human Serum Amyloid P | +Inquiry |
IgG-217H | Native Human Immunoglobulin G (IgG) | +Inquiry |
EDN3-8304H | Native Human EDN3 | +Inquiry |
Prothrombin-271B | Active Native Bovine Prothrombin Frag 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
P2RX2-3501HCL | Recombinant Human P2RX2 293 Cell Lysate | +Inquiry |
HIF3A-5563HCL | Recombinant Human HIF3A 293 Cell Lysate | +Inquiry |
KATNA1-888HCL | Recombinant Human KATNA1 cell lysate | +Inquiry |
CASP3-7838HCL | Recombinant Human CASP3 293 Cell Lysate | +Inquiry |
CD3E & CD3G-761HCL | Recombinant Human CD3E & CD3G cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ytfL Products
Required fields are marked with *
My Review for All ytfL Products
Required fields are marked with *
0
Inquiry Basket