Recombinant Full Length Universal Stress Protein B(Uspb) Protein, His-Tagged
Cat.No. : | RFL13627EF |
Product Overview : | Recombinant Full Length Universal stress protein B(uspB) Protein (A1AH31) (1-111aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-111) |
Form : | Lyophilized powder |
AA Sequence : | MISTVALFWALCVVCIVNMARYFSSLRALLVVLRNCDPLLYQYVDGGGFFTSHGQPNKQV RLVWYIYAQRYRDHHDDEFIRRCERVRRQFILTSALCGLVVVSLIALMIWH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | uspB |
Synonyms | uspB; Ecok1_34770; APECO1_2959; Universal stress protein B |
UniProt ID | A1AH31 |
◆ Native Proteins | ||
20S Immunoproteasome-225C | Active Native Cynomolgus monkey 20S Immunoproteasome protein | +Inquiry |
α-Crystallin-01B | Native Bovine α-Crystallin Protein | +Inquiry |
BCHE-8054H | Native Human Serum ButyrylcholinEsterase | +Inquiry |
F13A1-28806TH | Native Human F13A1 | +Inquiry |
Annexin-V-009H | Native Human Annexin-V Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PON2-3013HCL | Recombinant Human PON2 293 Cell Lysate | +Inquiry |
C19orf24-8213HCL | Recombinant Human C19orf24 293 Cell Lysate | +Inquiry |
RWDD1-1552HCL | Recombinant Human RWDD1 cell lysate | +Inquiry |
GLT1D1-715HCL | Recombinant Human GLT1D1 cell lysate | +Inquiry |
S100A10-2096HCL | Recombinant Human S100A10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All uspB Products
Required fields are marked with *
My Review for All uspB Products
Required fields are marked with *
0
Inquiry Basket