Recombinant Full Length Uncharacterized Protein Ynef(Ynef) Protein, His-Tagged
Cat.No. : | RFL2847EF |
Product Overview : | Recombinant Full Length Uncharacterized protein yneF(yneF) Protein (Q8XAZ4) (1-315aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-315) |
Form : | Lyophilized powder |
AA Sequence : | MLADWFSEQFSTGVLIVPCMLTLAIPGVLPRFKAEQMMPAIALIVSVIASVVIGGAGSLA FPLPALIWCAVRYTPQVTCLLTFVTGAVEIVLVANSVIDISVGSPFSIPQMFSARLGIAT MAICPIMVSFSVAAINSLMKQVALRADFDFLTQVYSRSGLYEALKSPSLKQTQHLTVMLL DIDYFKSINDNYGHECGDKVLSVFARHIQKIVGDKGLVARMGGEEFAVAVPSVNPVDGLL MAEKIRKGVELQPFTWQQKTLYLTVSIGVGSGRASYRTLTDDFNKLMVEADTCLYRSKKD GRNRTSTMRYGEEVV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dgcF |
Synonyms | dgcF; yneF; Z2182; ECs2129; Probable diguanylate cyclase DgcF; DGC |
UniProt ID | Q8XAZ4 |
◆ Recombinant Proteins | ||
TNNT3B-6170Z | Recombinant Zebrafish TNNT3B | +Inquiry |
ALOX12-269H | Recombinant Human ALOX12 | +Inquiry |
CHD-8609Z | Recombinant Zebrafish CHD | +Inquiry |
GNG10-6621H | Recombinant Human GNG10 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
KCNC3A-7803Z | Recombinant Zebrafish KCNC3A | +Inquiry |
◆ Native Proteins | ||
GPT-187H | Active Native Human Glutamate Pyruvate Transaminase | +Inquiry |
FGB-928P | Native Porcine Fibrinogen Protein | +Inquiry |
PGN-17S | Native S. aureus PGN Protein | +Inquiry |
ORM1-8013H | Native Human Serum Alpha-1-Acid GlycoProtein | +Inquiry |
LOC780933-24B | Native Bovine Immobilized Anhydrotrypsin | +Inquiry |
◆ Cell & Tissue Lysates | ||
GCSAML-8179HCL | Recombinant Human C1orf150 293 Cell Lysate | +Inquiry |
CPB-134R | Rabbit Anti-RSVgp07 Polyclonal Antibody | +Inquiry |
PHF5A-3226HCL | Recombinant Human PHF5A 293 Cell Lysate | +Inquiry |
FAM217B-102HCL | Recombinant Human FAM217B lysate | +Inquiry |
HIST1H4B-5526HCL | Recombinant Human HIST1H4B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All dgcF Products
Required fields are marked with *
My Review for All dgcF Products
Required fields are marked with *
0
Inquiry Basket