Recombinant Full Length Uncharacterized Protein T25E4.2(T25E4.2) Protein, His-Tagged
Cat.No. : | RFL33523CF |
Product Overview : | Recombinant Full Length Uncharacterized protein T25E4.2(T25E4.2) Protein (Q10015) (1-471aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-471) |
Form : | Lyophilized powder |
AA Sequence : | MKPGFKDLRAVGYQTDVPYVSLSNYCWSFNCPKPGAEVEFLNMTFQLMNSTATIVQIDAD IEQSIDMVSNGSADITLVSARQTLDRMKKVDFTTPIGFVYYGYLVREIPELAVADYIMRL FDYDTLAILISFGLIIGALLYLYTWIFGLRVRSLLDWMFISCSGIIHQFMFRISSPICAL VLIGFWLLCCLVIITYYEAKLKSFLLLSHHRGTIFNTLDGVLEAAEHKGWTLVIQERGYT PYLYCNPSQCARLDRLKSRFRFISLSLTDCSFLFRINFIGADDDANLLLGQDKHVGFSAL ASDLAETDITYFDYHSKILFVRDKIMAPEYLAYAVNKNVKGLREKFNRAVAYTKSGYGTV RSRYIASFPSYNSVTSQSQTITVLQTSHFIQLYKFCFIFYGIAIIVFILEIIFHRMTKNF TFFGHSYNYHLSGFEWRFARPKWIHFPRRNTVILPLSKSYSPDNERRVTVC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | T25E4.2 |
Synonyms | T25E4.2; Uncharacterized protein T25E4.2 |
UniProt ID | Q10015 |
◆ Native Proteins | ||
LTF-27590TH | Native Human LTF | +Inquiry |
Lactate dehydrogenase-039B | Active Native Bovine Lactate dehydrogenase Protein | +Inquiry |
C5-53H | Native Human Complement C5 | +Inquiry |
Collagen Type I & III-06M | Native Mouse Collagen Type I and III Protein | +Inquiry |
CSH1-31024TH | Native Human CSH1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMGN4-5471HCL | Recombinant Human HMGN4 293 Cell Lysate | +Inquiry |
RTP4-2116HCL | Recombinant Human RTP4 293 Cell Lysate | +Inquiry |
Parotid-379H | Human Parotid Membrane Tumor Lysate | +Inquiry |
TMEM237-8891HCL | Recombinant Human ALS2CR4 293 Cell Lysate | +Inquiry |
EPHA4-1446RCL | Recombinant Rat EPHA4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All T25E4.2 Products
Required fields are marked with *
My Review for All T25E4.2 Products
Required fields are marked with *
0
Inquiry Basket