Recombinant Full Length Uncharacterized Protein Rv1357C/Mt1400 (Rv1357C, Mt1400) Protein, His-Tagged
Cat.No. : | RFL36715HF |
Product Overview : | Recombinant Full Length Uncharacterized protein Rv1357c/MT1400 (Rv1357c, MT1400) Protein (P64829) (1-307aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-307) |
Form : | Lyophilized powder |
AA Sequence : | MDRCCQRATAFACALRPTKLIDYEEMFRGAMQARAMVANPDQWADSDRDQVNTRHYLSTS MRVALDRGEFFLVYQPIIRLADNRIIGAEALLRWEHPTLGTLLPGRFIDRAENNGLMVPL TAFVLEQACRHVRSWRDHSTDPQPFVSVNVSASTICDPGFLVLVEGVLGETGLPAHALQL ELAEDARLSRDEKAVTRLQELSALGVGIAIDDFGIGFSSLAYLPRLPVDVVKLGGKFIEC LDGDIQARLANEQITRAMIDLGDKLGITVTAKLVETPSQAARLRAFGCKAAQGWHFAKAL PVDFFRE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Uncharacterized protein Rv1357c/MT1400 (Rv1357c, MT1400) |
UniProt ID | P64829 |
◆ Recombinant Proteins | ||
ETFB-3524H | Recombinant Human ETFB, His-tagged | +Inquiry |
RFL2356DF | Recombinant Full Length Dioscorea Elephantipes Photosystem Ii D2 Protein(Psbd) Protein, His-Tagged | +Inquiry |
DACA-0160B | Recombinant Bacillus subtilis DACA protein, His-tagged | +Inquiry |
YDDC-3898B | Recombinant Bacillus subtilis YDDC protein, His-tagged | +Inquiry |
ACVR1-300C | Recombinant Canine ACVR1, His tagged | +Inquiry |
◆ Native Proteins | ||
GGT1-667H | Native Human Gamma-Glutamyl Transferase 1 | +Inquiry |
KS-01G | Active Native Goat KS Protein | +Inquiry |
C3b-09R | Native Rat C3b Protein | +Inquiry |
20S Immunoproteasome-224C | Active Native Cynomolgus monkey 20S Immunoproteasome protein | +Inquiry |
C4B-99H | Native Human C4b Binding Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAM8-855CCL | Recombinant Cynomolgus ADAM8 cell lysate | +Inquiry |
C14orf105-8292HCL | Recombinant Human C14orf105 293 Cell Lysate | +Inquiry |
L3MBTL4-965HCL | Recombinant Human L3MBTL4 cell lysate | +Inquiry |
TBK1-1745HCL | Recombinant Human TBK1 cell lysate | +Inquiry |
SDCCAG3-2013HCL | Recombinant Human SDCCAG3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Uncharacterized protein Rv1357c/MT1400 (Rv1357c, MT1400) Products
Required fields are marked with *
My Review for All Uncharacterized protein Rv1357c/MT1400 (Rv1357c, MT1400) Products
Required fields are marked with *
0
Inquiry Basket