Recombinant Full Length Uncharacterized Protein Rv0897C/Mt0921 (Rv0897C, Mt0921) Protein, His-Tagged
Cat.No. : | RFL14439HF |
Product Overview : | Recombinant Full Length Uncharacterized protein Rv0897c/MT0921 (Rv0897c, MT0921) Protein (P64751) (1-535aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-535) |
Form : | Lyophilized powder |
AA Sequence : | MSDHDRDFDVVVVGGGHNGLVAAAYLARAGLRVRLLERLAQTGGAAVSIQAFDGVEVALS RYSYLVSLLPSRIVADLGAPVRLARRPFSSYTPAPATAGRSGLLIGPTGEPRAAHLAAIG AAPDAHGFAAFYRRCRLVTARLWPTLIEPLRTREQARRDIVEYGGHEAAAAWQAMVDEPI GHAIAGAVANDLLRGVIATDALIGTFARMHEPSLMQNICFLYHLVGGGTGVWHVPIGGMG SVTSALATAAARHGAEIVTGADVFALDPDGTVRYHSDGSDGAEHLVRGRFVLVGVTPAVL ASLLGEPVAALAPGAQVKVNMVVRRLPRLRDDSVTPQQAFAGTFHVNETWSQLDAAYSQA ASGRLPDPLPCEAYCHSLTDPSILSARLRDAGAQTLTVFGLHTPHSVFGDTEGLAERLTA AVLASLNSVLAEPIQDVLWTDAQSKPCIETTTTLDLQRTLGMTGGNIFHGALSWPFADND DPLDTPARQWGVATDHERIMLCGSGARRGGAVSGIGGHNAAMAVLACLASRRKSP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Uncharacterized protein Rv0897c/MT0921 (Rv0897c, MT0921) |
UniProt ID | P64751 |
◆ Recombinant Proteins | ||
WWP2-2842H | Recombinant Human WWP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
S100A1-5645C | Recombinant Chicken S100A1 | +Inquiry |
WISP3-18557M | Recombinant Mouse WISP3 Protein | +Inquiry |
ARHGEF10-1144HF | Recombinant Full Length Human ARHGEF10 Protein, GST-tagged | +Inquiry |
MSS51-6472HF | Recombinant Full Length Human MSS51 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Troponin I-11H | Native Human Troponin I protein | +Inquiry |
MMP7-28205TH | Native Human MMP7 | +Inquiry |
Proteoglycans-53H | Native Human Proteoglycans | +Inquiry |
PLAT-30946TH | Native Human PLAT | +Inquiry |
IgA-241F | Native Ferret Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
PNPT1-1386HCL | Recombinant Human PNPT1 cell lysate | +Inquiry |
ZNF8-7HCL | Recombinant Human ZNF8 293 Cell Lysate | +Inquiry |
CEP55-7573HCL | Recombinant Human CEP55 293 Cell Lysate | +Inquiry |
APOC3-8782HCL | Recombinant Human APOC3 293 Cell Lysate | +Inquiry |
PFDN5-3278HCL | Recombinant Human PFDN5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Uncharacterized protein Rv0897c/MT0921 (Rv0897c, MT0921) Products
Required fields are marked with *
My Review for All Uncharacterized protein Rv0897c/MT0921 (Rv0897c, MT0921) Products
Required fields are marked with *
0
Inquiry Basket