Recombinant Full Length Uncharacterized Protein Mb0912 (Mb0912) Protein, His-Tagged
Cat.No. : | RFL8770MF |
Product Overview : | Recombinant Full Length Uncharacterized protein Mb0912 (Mb0912) Protein (P64744) (1-490aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium Bovis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-490) |
Form : | Lyophilized powder |
AA Sequence : | MDYAKRIGQVGALAVVLGVGAAVTTHAIGSAAPTDPSSSSTDSPVDACSPLGGSASSLAA IPGASVPQVGVRQVDPGSIPDDLLNALIDFLAAVRNGLVPIIENRTPVANPQQVSVPEGG TVGPVRFDACDPDGNRMTFAVRERGAPGGPQHGIVTVDQRTASFIYTADPGFVGTDTFSV NVSDDTSLHVHGLAGYLGPFHGHDDVATVTVFVGNTPTDTISGDFSMLTYNIAGLPFPLS SAILPRFFYTKEIGKRLNAYYVANVQEDFAYHQFLIKKSKMPSQTPPEPPTLLWPIGVPF SDGLNTLSEFKVQRLDRQTWYECTSDNCLTLKGFTYSQMRLPGGDTVDVYNLHTNTGGGP TTNANLAQVANYIQQNSAGRAVIVTGDFNARYSDDQSALLQFAQVNGLTDAWVQVEHGPT TPPFAPTCMVGNECELLDKIFYRSGQGVTLQAVSYGNEAPKFFNSKGEPLSDHSPAVVGF HYVADNVAVR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BQ2027_MB0912 |
Synonyms | BQ2027_MB0912; Sphingomyelinase; SMase |
UniProt ID | P64744 |
◆ Recombinant Proteins | ||
SIRPA-936MAF488 | Recombinant Mouse Sirpa Protein, hFc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
PAL-754P | Recombinant Pneumococcus phage Dp-1 PAL protein, His&Myc-tagged | +Inquiry |
YKTA-3181B | Recombinant Bacillus subtilis YKTA protein, His-tagged | +Inquiry |
PRMT5-4447H | Recombinant Human PRMT5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TECRL2B-1539Z | Recombinant Zebrafish TECRL2B | +Inquiry |
◆ Native Proteins | ||
F2-5401B | Native Bovine Coagulation Factor II (thrombin) | +Inquiry |
LOX3-185G | Native Glycine max LOX3 Protein | +Inquiry |
FGG-53S | Native Sheep Fibrinogen | +Inquiry |
CXCL9-30233TH | Native Human CXCL9 | +Inquiry |
FSH-930B | Active Native Bovine FSH Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CENPO-7578HCL | Recombinant Human CENPO 293 Cell Lysate | +Inquiry |
TMEM92-924HCL | Recombinant Human TMEM92 293 Cell Lysate | +Inquiry |
CCDC138-644HCL | Recombinant Human CCDC138 cell lysate | +Inquiry |
RPL30-2207HCL | Recombinant Human RPL30 293 Cell Lysate | +Inquiry |
CAPNS2-7858HCL | Recombinant Human CAPNS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All BQ2027_MB0912 Products
Required fields are marked with *
My Review for All BQ2027_MB0912 Products
Required fields are marked with *
0
Inquiry Basket