Recombinant Full Length Uncharacterized Protein Mb0644C (Mb0644C) Protein, His-Tagged
Cat.No. : | RFL7114MF |
Product Overview : | Recombinant Full Length Uncharacterized protein Mb0644c (Mb0644c) Protein (P64730) (1-383aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium Bovis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-383) |
Form : | Lyophilized powder |
AA Sequence : | MRIGVGVSTAPDVRRAAAEAAAHAREELAGGTPALAVLLGSRSHTDQAVDLLAAVQASVE PAALIGCVAQGIVAGRHELENEPAVAVWLASGPPAETFHLDFVRTGSGALITGYRFDRTA HDLHLLLPDPYSFPSNLLIEHLNTDLPGTTVVGGVVSGGRRRGDTRLFRDRDVLTSGLVG VRLPGAHSVSVVSQGCRPIGEPYIVTGADGAVITELGGRPPLHRLREIVLGMAPDEQELV SRGLQIGIVVDEHLAVPGQGDFLIRGLLGADPTTGAIGIGEVVEVGATVQFQVRDAAAAD KDLRLAVERAAAELPGPPVGGLLFTCNGRGRRMFGVTDHDASTIEDLLGGIPLAGFFAAG EIGPVAGHNALHGFTASMALFVD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BQ2027_MB0644C |
Synonyms | BQ2027_MB0644C; Uncharacterized protein Mb0644c |
UniProt ID | P64730 |
◆ Native Proteins | ||
ELANE-001H | Active Native Human ELANE Protein | +Inquiry |
Lectin-1718P | Native Peanut Lectin, PE conjugated | +Inquiry |
Lectin-1826P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein | +Inquiry |
20S Immunoproteasome-225C | Active Native Cynomolgus monkey 20S Immunoproteasome protein | +Inquiry |
EPX-8107H | Native Human Eosinophil Peroxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
PFDN5-3278HCL | Recombinant Human PFDN5 293 Cell Lysate | +Inquiry |
CTPS2-7196HCL | Recombinant Human CTPS2 293 Cell Lysate | +Inquiry |
COMMD6-7368HCL | Recombinant Human COMMD6 293 Cell Lysate | +Inquiry |
HPS5-5394HCL | Recombinant Human HPS5 293 Cell Lysate | +Inquiry |
SIGLEC11-1848HCL | Recombinant Human SIGLEC11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All BQ2027_MB0644C Products
Required fields are marked with *
My Review for All BQ2027_MB0644C Products
Required fields are marked with *
0
Inquiry Basket