Recombinant Full Length Uncharacterized Protein F32G8.4(F32G8.4) Protein, His-Tagged
Cat.No. : | RFL2789CF |
Product Overview : | Recombinant Full Length Uncharacterized protein F32G8.4(F32G8.4) Protein (Q19978) (1-405aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-405) |
Form : | Lyophilized powder |
AA Sequence : | MTISYDEEFSSLMLRWRGSIWKAVLKDLIGFYIAYYIVLAFQWYLLDEKGKEYFTGWIMW CEIGAQYIPLSFLLGFFVSLIVARWWEQFNCISWPDKMMIMVSACLPGNENMVVRQTIAR WSSLQAAIAWSGVSVKTLKRFPTERHMVASKLMTEEEYDLYMNTDAPHGKWFIPILWIVN LIKKQKQKGIIDSIQMDMLLKQVYSYRDGFAMLFVYDWIKIPLVYTQVVAIATYGYFFIC LIGRQPKLDQRSMEKEITILFPIFTTFQMLFYLGWLKVGQYLMNPFGEDDDDFELNYVLD RNTAIAHMMASELSDQLPSIGAPMVPAVPHTRASFKIQDVIPKSHLAGFKLSEAEMKLIK PEDLEEHERLMEETKVTNRQRLGTLVRALEKKSRTNATINEDDEE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | best-14 |
Synonyms | best-14; F32G8.4; Bestrophin homolog 14 |
UniProt ID | Q19978 |
◆ Recombinant Proteins | ||
HUTM-0822B | Recombinant Bacillus subtilis HUTM protein, His-tagged | +Inquiry |
FDXR-2650B | Recombinant Bovine FDXR Protein (33-492 aa), His-tagged | +Inquiry |
RFL4701EF | Recombinant Full Length Escherichia Coli Protoheme Ix Farnesyltransferase(Cyoe) Protein, His-Tagged | +Inquiry |
UFM1-6427R | Recombinant Rat UFM1 Protein | +Inquiry |
ERLIN2-4591HF | Recombinant Full Length Human ERLIN2 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CP-1767H | Native Human CP Protein | +Inquiry |
Factor Xia-65H | Native Human Factor Xia | +Inquiry |
C4B-1846H | Native Human C4B Protein | +Inquiry |
IgG-327H | Native HORSE IgG whole molecule | +Inquiry |
LDH1-16H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN23-7464HCL | Recombinant Human CLDN23 293 Cell Lysate | +Inquiry |
ACMSD-5HCL | Recombinant Human ACMSD lysate | +Inquiry |
PPP1R7-2933HCL | Recombinant Human PPP1R7 293 Cell Lysate | +Inquiry |
USP25-463HCL | Recombinant Human USP25 293 Cell Lysate | +Inquiry |
RNF214-2283HCL | Recombinant Human RNF214 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All best-14 Products
Required fields are marked with *
My Review for All best-14 Products
Required fields are marked with *
0
Inquiry Basket