Recombinant Full Length Uncharacterized Pe-Pgrs Family Protein Pe_Pgrs34(Pe_Pgrs34) Protein, His-Tagged
Cat.No. : | RFL20082HF |
Product Overview : | Recombinant Full Length Uncharacterized PE-PGRS family protein PE_PGRS34(PE_PGRS34) Protein (Q50594) (1-515aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-515) |
Form : | Lyophilized powder |
AA Sequence : | MSFVVAAPEVVVAAASDLAGIGSAIGAANAAAAVPTMGVLAAGADEVSAAVADLFGAHAQ AYQALSAQAALFHEQFVHAMTAGAGAYAGAEAADAAALDVLNGPFQALFGRPLIGDGANG APGQPGGPGGLLYGNGGNGGNGGIGQPGGAGGDAGLIGNGGNGGIGGPGATGLAGGAGGV GGLLFGDGGNGGAGGLGTGPVGATGGIGGPGGAAVGLFGHGGAGGAGGLGKAGFAGGAGG TGGTGGLLYGNGGNGGNVPSGAADGGAGGDARLIGNGGDGGSVGAAPTGIGNGGNGGNGG WLYGDGGSGGSTLQGFSDGGTGGNAGMFGDGGNGGFSFFDGNGGDGGTGGTLIGNGGDGG NSVQTDGFLRGHGGDGGNAVGLIGNGGAGGAGSAGTGVFAPGGGSGGNGGNGALLVGNGG AGGSGGPTQIPSVAVPVTGAGGTGGNGGTAGLIGNGGNGGAAGVSGDGTPGTGGNGGYAQ LIGDGGDGGPGDSGGPGGSGGTGGTLAGQNGSPGG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Uncharacterized PE-PGRS family protein PE_PGRS34(PE_PGRS34) |
UniProt ID | Q50594 |
◆ Recombinant Proteins | ||
GORASP1-203HF | Recombinant Full Length Human GORASP1 Protein | +Inquiry |
HABP-0095H | Recombinant Human HABP Protein | +Inquiry |
Hmbs-1133M | Recombinant Mouse Hmbs Protein, MYC/DDK-tagged | +Inquiry |
RFL367BF | Recombinant Full Length Bovine Vesicle-Associated Membrane Protein 2(Vamp2) Protein, His-Tagged | +Inquiry |
FMO5-2370R | Recombinant Rat FMO5 Protein | +Inquiry |
◆ Native Proteins | ||
HNMT-1355R | Active Native Rat HNMT Protein | +Inquiry |
ApoE-3560H | Native Human ApoE | +Inquiry |
C4BPB-184H | Native Human C4b-Binding Protein | +Inquiry |
KNG1-18H | Native Human Kininogen, LMW | +Inquiry |
ACHE-8345H | Native Human ACHE | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSNARE1-706HCL | Recombinant Human TSNARE1 lysate | +Inquiry |
NDUFS8-3892HCL | Recombinant Human NDUFS8 293 Cell Lysate | +Inquiry |
SFMBT1-1914HCL | Recombinant Human SFMBT1 293 Cell Lysate | +Inquiry |
ZNF500-63HCL | Recombinant Human ZNF500 293 Cell Lysate | +Inquiry |
PHC3-1343HCL | Recombinant Human PHC3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Uncharacterized PE-PGRS family protein PE_PGRS34(PE_PGRS34) Products
Required fields are marked with *
My Review for All Uncharacterized PE-PGRS family protein PE_PGRS34(PE_PGRS34) Products
Required fields are marked with *
0
Inquiry Basket