Recombinant Full Length Uncharacterized Membrane Protein Ycf78(Ycf78) Protein, His-Tagged
Cat.No. : | RFL26445PF |
Product Overview : | Recombinant Full Length Uncharacterized membrane protein ycf78(ycf78) Protein (Q9TJR3) (1-586aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Prototheca wickerhamii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-586) |
Form : | Lyophilized powder |
AA Sequence : | MSLSTHIRDYVEVLTGVTEASGNPLQLAKLISESLLYVLKICQSEVLQILSFQWIRNFSL LPIKIPAIYESIIGQTPPEALFDFVEVLHLGQNPVIAGFLNSAFFALPFSAIHFVSIRRL LTQGVPAAIYSFGGYIIGQILFMSCVIFGVQDIIIPWLTLEPLNYIAGLILLSRIIISMR FESLAELETWDHPKYKNYFIYRFLIAWCEQGSIFQFLSNITPSANPTILQGFAFNNLGLN LVQNFSYIGGLLLGSAAFTLFWMWLFLKIQTYILVHTLYYHHQIVATVNQICFLSALTLS FATLPYYAYNYLLVGPLGFVPEDNALLSTVFTHSYLKDGPKELSFLTEEPIMELKLFPFN KGQYLIFPELYQTLSLEELSYRADYAWVRRVEKFSLDVTATHVGGRKLARRLGFHKLRQS FAKLILPRQTLAMDYRLELNSKYKCEDHDADIKAILDSELTNTRKESSIRGRRYRGDLSY DPTLDRFYQWYDFENVSLESSDQMMNYVTRTSVQGRFLFPQSFIKKEINLGEIHHEIGLR IKQQYNQSLIFRTLLKVDISFLLARQPKKHHLSGDQECDLQIKRNI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ycf78 |
Synonyms | ycf78; ycf1; Uncharacterized membrane protein ycf78; ycf1 |
UniProt ID | Q9TJR3 |
◆ Recombinant Proteins | ||
Gtdc1-3322M | Recombinant Mouse Gtdc1 Protein, Myc/DDK-tagged | +Inquiry |
YFMC-1971B | Recombinant Bacillus subtilis YFMC protein, His-tagged | +Inquiry |
METTL20-2563R | Recombinant Rhesus Macaque METTL20 Protein, His (Fc)-Avi-tagged | +Inquiry |
SAOUHSC-00580-4668S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SAOUHSC_00580 protein, His-tagged | +Inquiry |
COX7C-10357Z | Recombinant Zebrafish COX7C | +Inquiry |
◆ Native Proteins | ||
C1q-04M | Native Mouse C1q Protein | +Inquiry |
Artery-015H | Human Artery Lysate, Total Protein | +Inquiry |
EDN2-8310H | Native Human EDN2 | +Inquiry |
IgG-356B | Native Bovine Gamma Globulin Fraction | +Inquiry |
GPT-187H | Active Native Human Glutamate Pyruvate Transaminase | +Inquiry |
◆ Cell & Tissue Lysates | ||
DGKB-6959HCL | Recombinant Human DGKB 293 Cell Lysate | +Inquiry |
ZNF343-2015HCL | Recombinant Human ZNF343 cell lysate | +Inquiry |
PP2D1-114HCL | Recombinant Human PP2D1 lysate | +Inquiry |
GNG13-5854HCL | Recombinant Human GNG13 293 Cell Lysate | +Inquiry |
CD274-2735HCL | Recombinant Human CD274 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ycf78 Products
Required fields are marked with *
My Review for All ycf78 Products
Required fields are marked with *
0
Inquiry Basket