Recombinant Full Length Uncharacterized Membrane Protein Rv2637/Mt2715 (Rv2637, Mt2715) Protein, His-Tagged
Cat.No. : | RFL10202HF |
Product Overview : | Recombinant Full Length Uncharacterized membrane protein Rv2637/MT2715 (Rv2637, MT2715) Protein (P63911) (1-218aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-218) |
Form : | Lyophilized powder |
AA Sequence : | MDVEALLQSIPPLMVYLVVGAVVGIESLGIPLPGEIVLVSAAVLSSHPELAVNPIGVGGA AVIGAVVGDSIGYSIGRRFGLPLFDRLGRRFPKHFGPGHVALAERLFNRWGVRAVFLGRF IALLRIFAGPLAGALKMPYPRFLAANVTGGICWAGGTTALVYFAGMAAQHWLERFSWIAL VIAVIAGITAAILLRERTSRAIAELEAEHCRKAGTTAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Uncharacterized membrane protein Rv2637/MT2715 (Rv2637, MT2715) |
UniProt ID | P63911 |
◆ Native Proteins | ||
CYTC-168E | Native Horse Cytochrome C | +Inquiry |
Urease-52J | Active Native Jack Bean Urease | +Inquiry |
Lectin-1809M | Active Native Maackia Amurensis Lectin II Protein, Biotinylated | +Inquiry |
PLG-1867B | Native Bovine PLG Protein | +Inquiry |
LTA-18S | Native S. aureus LTA Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CA10-1810MCL | Recombinant Mouse CA10 cell lysate | +Inquiry |
PSME3-2739HCL | Recombinant Human PSME3 293 Cell Lysate | +Inquiry |
RPS21-1542HCL | Recombinant Human RPS21 cell lysate | +Inquiry |
TINF2-1060HCL | Recombinant Human TINF2 293 Cell Lysate | +Inquiry |
Ovary-846P | Pig Ovary Membrane Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Uncharacterized membrane protein Rv2637/MT2715 (Rv2637, MT2715) Products
Required fields are marked with *
My Review for All Uncharacterized membrane protein Rv2637/MT2715 (Rv2637, MT2715) Products
Required fields are marked with *
0
Inquiry Basket