Recombinant Full Length Uncharacterized Abc Transporter Atp-Binding Protein Rv1273C/Mt1311 (Rv1273C, Mt1311) Protein, His-Tagged
Cat.No. : | RFL23723HF |
Product Overview : | Recombinant Full Length Uncharacterized ABC transporter ATP-binding protein Rv1273c/MT1311 (Rv1273c, MT1311) Protein (P0A4W4) (1-582aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-582) |
Form : | Lyophilized powder |
AA Sequence : | MLLALLRQHIRPYRRLVAMLMMLQLVSTLASLYLPTVNAAIVDDGVAKGDTATIVRLGAV MLGVTGLQVLCAIGAVYLGSRTGAGFGRDLRSAMFEHIITFSERETARFGAPTLLTRSTN DVRQILFLVQMTATVLVTAPIMCVGGIIMAIHQEAALTWLLLVSVPILAVANYWIISHML PLFRRMQSLIDGINRVMRDQLSGVRVVRAFTREGYERDKFAQANTALSNAALSAGNWQAL MLPVTTLTINASSVALIWFGGLRIDSGQMQVGSLIAFLSYFAQILMAVLMATMTLAVLPR ASVCAERITEVLSTPAALGNPDNPKFPTDGVTGVVRLAGATFTYPGADCPVLQDISLTAR PGTTTAIVGSTGSGKSTLVSLICRLYDVTAGAVLVDGIDVREYHTERLWSAIGLVPQRSY LFSGTVADNLRYGGGPDQVVTEQEMWEALRVAAADGFVQTDGLQTRVAQGGVNFSGGQRQ RLAIARAVIRRPAIYVFDDAFSALDVHTDAKVHASLRQVSGDATIIVVTQRISNAAQADQ VIVVDNGKIVGTGTHETLLADCPTYAEFAASQSLSATVGGVG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Uncharacterized ABC transporter ATP-binding protein Rv1273c/MT1311 (Rv1273c, MT1311) |
UniProt ID | P0A4W4 |
◆ Recombinant Proteins | ||
FIS1-31247TH | Recombinant Human FIS1, His-tagged | +Inquiry |
RFL18197BF | Recombinant Full Length Bacillus Cereus Upf0421 Protein Bce_2776(Bce_2776) Protein, His-Tagged | +Inquiry |
TRMO-2084HFL | Recombinant Full Length Human TRMO Protein, C-Flag-tagged | +Inquiry |
CACUL1-605R | Recombinant Rhesus monkey CACUL1 Protein, His-tagged | +Inquiry |
PTH2R-693HF | Recombinant Full Length Human PTH2R Protein | +Inquiry |
◆ Native Proteins | ||
Alb-113R | Native Rat Serum Albumin | +Inquiry |
GSN-874P | Active Native Porcine GSN Protein | +Inquiry |
IgA-203H | Native Human Immunoglobulin A | +Inquiry |
GLDH-120B | Active Native Bovine Glutamate Dehydrogenase | +Inquiry |
MUC2-28P | Native Pig Mucin 2 (MUC2) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM8B-260HCL | Recombinant Human TMEM8B cell lysate | +Inquiry |
ZFP42-1977HCL | Recombinant Human ZFP42 cell lysate | +Inquiry |
MIP-410HCL | Recombinant Human MIP lysate | +Inquiry |
Skeletal Muscle-55H | Human Skeletal Muscle Tissue Lysate | +Inquiry |
MZB1-4338HCL | Recombinant Human MGC29506 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Uncharacterized ABC transporter ATP-binding protein Rv1273c/MT1311 (Rv1273c, MT1311) Products
Required fields are marked with *
My Review for All Uncharacterized ABC transporter ATP-binding protein Rv1273c/MT1311 (Rv1273c, MT1311) Products
Required fields are marked with *
0
Inquiry Basket