Recombinant Full Length Type Ii Secretion System Protein L(Outl) Protein, His-Tagged
Cat.No. : | RFL18777DF |
Product Overview : | Recombinant Full Length Type II secretion system protein L(outL) Protein (P31707) (1-399aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dickeya chrysanthemi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-399) |
Form : | Lyophilized powder |
AA Sequence : | MSKAENTSGKQQLILRLSADTSDSLEWLIWSVSRHQTLTTGSGTLESLQAVLADYPVISA RVLVPSTDVTFHTLSLPRQSRRQLLQAIPFMLEEQVASDIDQLHFAVMDMHGDNATVAVV QKSRLRAWLNQCETLGVPVETVVPDVMALPRADSAWSAISHRNLWLFRLDSGIGMAAEEN WYQSLLAFQPLPAVHCYSPVPASALTWQPQPVTDLLTLAAQVNLSMSMDLRQGEYAPVKP WKQALLPWRNVLIALSAWLLLVLGESVWTHYQWYRQADYWRQESVRVYRKLFPDEKQVVN PRAQMQRHLQEVRAGVSGFALTEQMNRLQQLVAQNEGVSLQSLSYDRSRDELRLSLRATS YAQMEQFRQQAQAYFQIPPGEMKQEKDHVEGQLTLRSQP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | outL |
Synonyms | outL; Type II secretion system protein L; T2SS protein L; General secretion pathway protein L; Pectic enzymes secretion protein OutL |
UniProt ID | P31707 |
◆ Recombinant Proteins | ||
CDK2-5392H | Recombinant Human CDK2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PDE4B-3991R | Recombinant Rat PDE4B Protein, His (Fc)-Avi-tagged | +Inquiry |
FCRL5-12831H | Recombinant Human FCRL5, His-tagged | +Inquiry |
GPR113-7128M | Recombinant Mouse GPR113 Protein | +Inquiry |
GABRA6-6148M | Recombinant Mouse GABRA6 Protein | +Inquiry |
◆ Native Proteins | ||
PLAT-29690TH | Native Human Human SERPINE1 | +Inquiry |
Troponin-16R | Native Rabbit Skeletal Muscle Troponin ITC Complex | +Inquiry |
Plg-297M | Active Native Mouse Plasmin | +Inquiry |
RWV-307S | Native Snake RVV-V ACTIVATOR | +Inquiry |
ALB-315B | Native Bovine ALB protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CUL1-7185HCL | Recombinant Human CUL1 293 Cell Lysate | +Inquiry |
TMUB2-786HCL | Recombinant Human TMUB2 cell lysate | +Inquiry |
JUP-5094HCL | Recombinant Human JUP 293 Cell Lysate | +Inquiry |
MATN4-4448HCL | Recombinant Human MATN4 293 Cell Lysate | +Inquiry |
Stomach-547E | Equine Stomach Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All outL Products
Required fields are marked with *
My Review for All outL Products
Required fields are marked with *
0
Inquiry Basket