Recombinant Full Length Turkey Rhinotracheitis Virus Small Hydrophobic Protein(Sh) Protein, His-Tagged
Cat.No. : | RFL11687TF |
Product Overview : | Recombinant Full Length Turkey rhinotracheitis virus Small hydrophobic protein(SH) Protein (P33496) (1-174aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Turkey rhinotracheitis virus (TRTV) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-174) |
Form : | Lyophilized powder |
AA Sequence : | MTSTVNLGSDTASKRTVIKSRCNSCCRILVSCVAVICAILALIFLVATIGLSVKLAFTVQ EVHNCKQKLSGASTTTAAIYTTPSTMIEALQTNQLKLTTNERRSTPPDCLVEKKLCEGEV RYLKTKGCLGAREGEDLNCIDLVVECVGKPCGHNEDYKECICTNNGTATKCCYN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SH |
Synonyms | SH; Small hydrophobic protein |
UniProt ID | P33496 |
◆ Recombinant Proteins | ||
CD200R1-1240R | Recombinant Rat CD200R1 Protein | +Inquiry |
TOR1A-2390C | Recombinant Chicken TOR1A | +Inquiry |
RFL9859EF | Recombinant Full Length Escherichia Coli O8 Protein Aaex(Aaex) Protein, His-Tagged | +Inquiry |
AHRR-406M | Recombinant Mouse AHRR Protein, His (Fc)-Avi-tagged | +Inquiry |
CDK5R2-1024H | Recombinant Human CDK5R2 Protein, GST-Tagged | +Inquiry |
◆ Native Proteins | ||
LDH-216S | Active Native Porcine Lactate Dehydrogenase | +Inquiry |
Lectin-1739H | Active Native Hippeastrum Hybrid (Amaryllis) Lectin Protein | +Inquiry |
CAT-21H | Native Human Catalase Protein | +Inquiry |
Complement C4b-51H | Native Human Complement C4b | +Inquiry |
Skin-008H | Human Skin Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRLF1-404HCL | Recombinant Human CRLF1 cell lysate | +Inquiry |
GLRX2-714HCL | Recombinant Human GLRX2 cell lysate | +Inquiry |
ALAS1-8924HCL | Recombinant Human ALAS1 293 Cell Lysate | +Inquiry |
HLA-DPA1-5506HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
FAM228A-8060HCL | Recombinant Human C2orf84 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SH Products
Required fields are marked with *
My Review for All SH Products
Required fields are marked with *
0
Inquiry Basket