Recombinant Full Length Trypanosoma Brucei Brucei Phosphatidylcholine:Ceramide Cholinephosphotransferase 4(Sls4) Protein, His-Tagged
Cat.No. : | RFL12726TF |
Product Overview : | Recombinant Full Length Trypanosoma brucei brucei Phosphatidylcholine:ceramide cholinephosphotransferase 4(SLS4) Protein (Q38E56) (1-365aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Trypanosoma brucei |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-365) |
Form : | Lyophilized powder |
AA Sequence : | MISYPFFSLSPPGLVPPPMAVPPVEMYSGSFWNRMRKPLPLRTQVIRFTVVFVIVSFILA VALQITHERMPDPKVTKPLPDLGFELLTKVPGMYVLADCCIGFLNILSVFTAFKLYLLHR HCVGSGEPELPCNIPGVSRFFLSVWLCKENCRIELRNVHTIAWIRFITSYALLLLFRSVV IVMTSLPAPDDLCQDPPKIENPVKNVILTVLTAGGGSIHCGDLMYSGHTVILTLHLMFHW IYGAMVHWSFRPVVTVVAIFGYYCIVASRFHYTDDVLVAIYLTIATFIAVGHNADGAPWQ LQLFIRWLPCCGANSREMTEDSQPVMVAFKSEELDEMNGVLEGRQKKHGGVGDGEALMFK CGAYV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SLS4 |
Synonyms | SLS4; Tb09.211.1000; Phosphatidylcholine:ceramide cholinephosphotransferase 4; Ethanolamine-phosphorylceramide synthase; EPC synthase; Sphingolipid synthase; Sphingomyelin synthase; SM synthase |
UniProt ID | Q38E56 |
◆ Recombinant Proteins | ||
ABHD3-216M | Recombinant Mouse ABHD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RBMY1B-1748H | Recombinant Human RBMY1B | +Inquiry |
Plau-1365M | Recombinant Mouse Plau protein, His-Avi-tagged | +Inquiry |
IL1RN-5230H | Recombinant Human IL1RN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GRAMD1A-7237M | Recombinant Mouse GRAMD1A Protein | +Inquiry |
◆ Native Proteins | ||
Lectin-1828P | Active Native Pisum Sativum Agglutinin Protein, Biotinylated | +Inquiry |
F10-63H | Native Human Factor X | +Inquiry |
Lectin-1740A | Active Native Aleuria Aurantia Lectin Protein | +Inquiry |
SERPINE1-5514R | Native Rabbit Serpin Peptidase Inhibitor, Clade E (nexin, plasminogen activator inhibitor type 1), Member 1 | +Inquiry |
Lectin-1859W | Active Native Wheat Germ Agglutinin Protein, Agarose bound | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCOLCE-3375HCL | Recombinant Human PCOLCE 293 Cell Lysate | +Inquiry |
ARL2-8716HCL | Recombinant Human ARL2 293 Cell Lysate | +Inquiry |
LAMA5-968HCL | Recombinant Human LAMA5 cell lysate | +Inquiry |
HA-2340HCL | Recombinant H1N1 HA cell lysate | +Inquiry |
RNASE4-2319HCL | Recombinant Human RNASE4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLS4 Products
Required fields are marked with *
My Review for All SLS4 Products
Required fields are marked with *
0
Inquiry Basket