Recombinant Full Length Treponema Pallidum Uncharacterized Protein Tp_0260 (Tp_0260) Protein, His-Tagged
Cat.No. : | RFL28388TF |
Product Overview : | Recombinant Full Length Treponema pallidum Uncharacterized protein TP_0260 (TP_0260) Protein (O83284) (1-448aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Treponema Pallidum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-448) |
Form : | Lyophilized powder |
AA Sequence : | MCYYRYVQVHSIWRRFCALGLLVPFLLLLFSCTNTVGYGVLQWSLPDLGLSTGDILPVYV RSNVSQVYIVEIQKKKVELPFWQLKLCRTKKEALQYAERLREYRYSYATSVLDGLPLREG PENTAPQVYRLREGQAVKLLWKGTGKAVYRGENRLEGDWFKVMTEDGTTGWCFSHGLSLF DERESRPTVRETDDLARDRDLQHVLNSAWYPEYYRTMVEQRRIDLEKMASGWGLFVGEKK GLARIELPDAHYAFPYSRLVKTGSNGYLFDGSSLSIYVRDAHTLAAQFTDEAGRLRIERF VTLEKTPEEIIAEEQLRRSALLEHVCTPGLRLHSEIYGTLSFTERNVFTWTGARALSPAL IPAGAGSTGRVALRCFIDQSLKSEYEGVLSFDFDSAQEWVHFLYLRTPGGLKLEHIDSTH LKDATVLRRSVSPVVLYFAPEGHAEPQP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TP_0260 |
Synonyms | TP_0260; Uncharacterized protein TP_0260 |
UniProt ID | O83284 |
◆ Recombinant Proteins | ||
DNAN-0631B | Recombinant Bacillus subtilis DNAN protein, His-tagged | +Inquiry |
GBA3-626H | Recombinant Human glucosidase, beta, acid 3, His-tagged | +Inquiry |
TNIK-1073H | Recombinant Human TNIK Protein (D11-G314), Tag Free | +Inquiry |
CCDC25-10796H | Recombinant Human CCDC25, GST-tagged | +Inquiry |
Flt3l-457M | Recombinant Mouse Flt3l protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
KRT19-382H | Native Human KRT19 | +Inquiry |
ADVag-281V | Active Native ADV Protein | +Inquiry |
APOA1-256H | Native Human APOA1 protein | +Inquiry |
AGE-39 | Active Native Human Advanced Glycation End Product (AGE) Protein | +Inquiry |
COL6-116H | Native Human Collagen type VI | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCBD2-3404HCL | Recombinant Human PCBD2 293 Cell Lysate | +Inquiry |
IL4R-2719HCL | Recombinant Human IL4R cell lysate | +Inquiry |
TAF15-1274HCL | Recombinant Human TAF15 293 Cell Lysate | +Inquiry |
Tobacco-713P | Tobacco Lysate, Total Protein | +Inquiry |
PILRA-002HCL | Recombinant Human PILRA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All TP_0260 Products
Required fields are marked with *
My Review for All TP_0260 Products
Required fields are marked with *
0
Inquiry Basket