Recombinant Full Length Treponema Pallidum Protein Hflk(Hflk) Protein, His-Tagged
Cat.No. : | RFL31535TF |
Product Overview : | Recombinant Full Length Treponema pallidum Protein HflK(hflK) Protein (O83151) (1-328aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Treponema Pallidum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-328) |
Form : | Lyophilized powder |
AA Sequence : | MRIPKWTPATWSVVAGCIGGVLGIVIVGIASPIRIISPTDNGVVTRFGKYHRTLEPGLHY LIPFVEWVYKVPVTKVQKEEFGFRTSKSSEQSHYVNNISHESLMLTGDLNIVDVEWVVQY RIVDPRAWVFNVESQERRQTIRDISKAVVNSLIGDRAILDIMGPERSAIQMRAKDMMNVL LKRIGLGVLVSSVQLQNVVPPQEVQQAFEDVNIAIQDMNRLINEGKESYNREIPKARGDA DKLIQEAMGYANERVNRAKGDVARFDSIYAEYVKAPHVTKTRLYLEGLGAILEKTENVLL IDKKLENLLTLKDISKVSKKVVAGTREE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | hflK |
Synonyms | hflK; TP_0113; Protein HflK |
UniProt ID | O83151 |
◆ Recombinant Proteins | ||
nsP3-432V | Recombinant Ross River Virus nsP3 Protein, GST&His-tagged | +Inquiry |
ENKD1-2852H | Recombinant Human ENKD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL23620PF | Recombinant Full Length Pasteurella Multocida Protease Htpx(Htpx) Protein, His-Tagged | +Inquiry |
PLN-1928H | Recombinant Human PLN protein, His & GST-tagged | +Inquiry |
SAP048A-008-2568S | Recombinant Staphylococcus aureus (strain: NE 3809) SAP048A_008 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
TPSAB1-02H | Active Native Human TPSAB1 Protein | +Inquiry |
APOC2-27331TH | Native Human APOC2 protein | +Inquiry |
MYS-01R | Active Native Rabbit Heavy Meromyosin Protein | +Inquiry |
Collagen-46M | Native Mouse Collagen protein | +Inquiry |
CFB-104H | Native Human Factor B | +Inquiry |
◆ Cell & Tissue Lysates | ||
MFAP3-4350HCL | Recombinant Human MFAP3 293 Cell Lysate | +Inquiry |
MAGEA2B-4554HCL | Recombinant Human MAGEA2B 293 Cell Lysate | +Inquiry |
Intestine-767C | Chicken Intestine Membrane Lysate, Total Protein | +Inquiry |
NPAP1-8271HCL | Recombinant Human C15orf2 293 Cell Lysate | +Inquiry |
SURF2-1336HCL | Recombinant Human SURF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All hflK Products
Required fields are marked with *
My Review for All hflK Products
Required fields are marked with *
0
Inquiry Basket