Recombinant Full Length Treponema Pallidum Flagellar Protein Flil(Flil) Protein, His-Tagged
Cat.No. : | RFL11069TF |
Product Overview : | Recombinant Full Length Treponema pallidum Flagellar protein FliL(fliL) Protein (O07888) (1-182aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Treponema Pallidum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-182) |
Form : | Lyophilized powder |
AA Sequence : | MAEKDSIGDIADDFEEQLVAPAADRVGFLPGLLRWVAIAVGAVIFIVTVVTATALVLAKQ GSSHTAYPVSQEFRESRELLQYYESVGLIRTNTADALPGTVVVSVALGYPLNDKTAQQEL SARLVELKDFLRSYFQRKTLSELRPEHEQKVKIEIRNEINDNVLSRSKVKDIRFTQFDVL KP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fliL |
Synonyms | fliL; TP_0722; Flagellar protein FliL |
UniProt ID | O07888 |
◆ Native Proteins | ||
CAT-1847B | Active Native Bovine, Catalase | +Inquiry |
PYGB-03H | Native Human PYGB Protein | +Inquiry |
ALPI-5B | Active Native Bovine Alkaline Phosphatase | +Inquiry |
SERPING1-97H | Active Native Human C1 Esterase Inhibitor (C1-INH) | +Inquiry |
FG-163B | Native Bovine fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
METTL14-4358HCL | Recombinant Human METTL14 293 Cell Lysate | +Inquiry |
S1PR1-530HCL | Recombinant Human S1PR1 cell lysate | +Inquiry |
NOSIP-3758HCL | Recombinant Human NOSIP 293 Cell Lysate | +Inquiry |
Kidney-276H | Human Kidney Tumor Lysate | +Inquiry |
SLC6A20-1705HCL | Recombinant Human SLC6A20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All fliL Products
Required fields are marked with *
My Review for All fliL Products
Required fields are marked with *
0
Inquiry Basket