Recombinant Full Length Trachypithecus Francoisi Mas-Related G-Protein Coupled Receptor Member X2(Mrgprx2) Protein, His-Tagged
Cat.No. : | RFL11327TF |
Product Overview : | Recombinant Full Length Trachypithecus francoisi Mas-related G-protein coupled receptor member X2(MRGPRX2) Protein (Q4QXU4) (1-330aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Trachypithecus francoisi (Francois' leaf monkey) (Presbytis francoisi) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-330) |
Form : | Lyophilized powder |
AA Sequence : | MDPTTLVWGTESTTMNGNDQALPLLCGKETLILVVLILFIALVGLVGNAFVLWLLGFRMR RNAFSVYVLSLAGADFLFLCFPMINCLAYLINFFHSISINFPSFFTTVMTCAYLAGLSML SAISTERCLSVLWPIWYRSRRPRHLSAVMCVLLWALSLLLSILEGKFCGFLFSDGDSGWC QTFDFITAAWLMFLFVVLCGSSLALLVRILCGSRGLPLTRLYLTILLTVLIFLLCGLPFG IQWFLILWIWKNSDVLFCHIHPVSVVLSSFNSSANPIIYFFVGSFRKQWRLRQPVLKLAL QRALQDTAEVDHSEGCFSQGTLEMSGSSLV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MRGPRX2 |
Synonyms | MRGPRX2; MRGX2; Mas-related G-protein coupled receptor member X2 |
UniProt ID | Q4QXU4 |
◆ Recombinant Proteins | ||
TEAD4-1005H | Recombinant Human TEAD4 Protein (74-434 aa), His-SUMO-tagged | +Inquiry |
NF2-6029M | Recombinant Mouse NF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SUK-0024P2-2385S | Recombinant Staphylococcus aureus (strain: 18811) SUK_0024P2 protein, His-tagged | +Inquiry |
RFL29597BF | Recombinant Full Length Bacillus Subtilis Uncharacterized Protein Yddb(Yddb) Protein, His-Tagged | +Inquiry |
SOX19A-8549Z | Recombinant Zebrafish SOX19A | +Inquiry |
◆ Native Proteins | ||
BGLAP-59B | Native Bovine Osteocalcin | +Inquiry |
Prothrombin-271B | Active Native Bovine Prothrombin Frag 1 | +Inquiry |
Deoxycholate-03T | Native Toxoplasma Gondii Deoxycholate Lysate, RH strain | +Inquiry |
Factor Ixa-62H | Native Human Factor Ixa | +Inquiry |
CKMB-12H | Active Native Human Creatine Kinase MB protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF10B-2829HCL | Recombinant Human TNFRSF10B cell lysate | +Inquiry |
REG1A-1364RCL | Recombinant Rat REG1A cell lysate | +Inquiry |
MAPK9-4486HCL | Recombinant Human MAPK9 293 Cell Lysate | +Inquiry |
ANKRD54-8846HCL | Recombinant Human ANKRD54 293 Cell Lysate | +Inquiry |
MTHFR-4081HCL | Recombinant Human MTHFR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRGPRX2 Products
Required fields are marked with *
My Review for All MRGPRX2 Products
Required fields are marked with *
0
Inquiry Basket