Recombinant Full Length Tolumonas Auensis Probable Ubiquinone Biosynthesis Protein Ubib(Ubib) Protein, His-Tagged
Cat.No. : | RFL8858TF |
Product Overview : | Recombinant Full Length Tolumonas auensis Probable ubiquinone biosynthesis protein UbiB(ubiB) Protein (C4L962) (1-543aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Tolumonas auensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-543) |
Form : | Lyophilized powder |
AA Sequence : | MILREWRRFYTIGSVLLRHGLDELIPRHWQPWPVRLFRRSLFWLRNRYPEQSRGARLRHA FEGLGPVFIKFGQMLSTRRDLLPPDLAEELAMLQDRVPSFDGQLAREQIEQALGQPIEAL FADFDQQPLASASVAQVHTARLKENNAEIVIKVIRPDIKPVINDDIRLMRLCAKIVAFLI PNNRLRPVEVIEEYRRTLLDELNLMSEAANAIQLRRNFENSSHLYVPLVYSDYCRESVLV MERIYGIPVSDRAALEANGTDLKLLAERGVEVFFTQVFRDSFFHADMHPGNVFVSYEHPH DPQWIGIDCGIVGTLNRQDKRYLAENFLAFFNRDYRKVAELHVQSGWVPPDTKVEEFESA LRTVLEPIFAKPLAEISFGQVLLNLFNTARRFNMHVQPQLVLLQKTLLYIEGLGRHLYPQ LDLWQTAKPFLEHWMRQQIGPKAAWRAIKEKAPFWAEKLPDMPDLIYDTLTQVQHQQHMV KGLYQQYHQQHRRHAQARFLLGAGATLLLGSILLLPTHEQLASAGLTISIICWLNGWWKI SRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ubiB |
Synonyms | ubiB; Tola_0331; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB |
UniProt ID | C4L962 |
◆ Recombinant Proteins | ||
GTPBP8-4004M | Recombinant Mouse GTPBP8 Protein, His (Fc)-Avi-tagged | +Inquiry |
IGLON5-1161H | Recombinant Human IGLON5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CENPV-1128H | Recombinant Human CENPV Protein, GST-Tagged | +Inquiry |
ACOX3-9304H | Recombinant Human ACOX3, GST-tagged | +Inquiry |
RFL14042OF | Recombinant Full Length Oryza Sativa Subsp. Indica Casp-Like Protein Osi_39071 (Osi_39071) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
TF-172S | Native Sheep transferrin | +Inquiry |
RPE-426 | Native RPE | +Inquiry |
IgA-240B | Native Bovine Immunoglobulin A | +Inquiry |
ApoB-3556H | Native Human ApoB | +Inquiry |
Proteoglycans-54B | Native Bovine Proteoglycans | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADD1-9017HCL | Recombinant Human ADD1 293 Cell Lysate | +Inquiry |
STAU1-1414HCL | Recombinant Human STAU1 293 Cell Lysate | +Inquiry |
HSPBAP1-5343HCL | Recombinant Human HSPBAP1 293 Cell Lysate | +Inquiry |
ITGA3-5134HCL | Recombinant Human ITGA3 293 Cell Lysate | +Inquiry |
RAE1-2550HCL | Recombinant Human RAE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ubiB Products
Required fields are marked with *
My Review for All ubiB Products
Required fields are marked with *
0
Inquiry Basket