Recombinant Full Length Thiol:Disulfide Interchange Protein Dsbd(Dsbd) Protein, His-Tagged
Cat.No. : | RFL5112SF |
Product Overview : | Recombinant Full Length Thiol:disulfide interchange protein DsbD(dsbD) Protein (Q8Z1A8) (20-567aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (20-567) |
Form : | Lyophilized powder |
AA Sequence : | GLFDAPGRSQFVPADRAFVFDFQQNQHDLTLSWQVKEGYYLYRKQISITPTKADIAAVQL PAGVWHEDEFYGKSEIYRKRLNVPVTVNQAAAGATLTITYQGCADAGFCYPPETKTVPLS EVAAAIDATPTPAVTQTGETSKPAAQLPFSALWALLIGIGIAFTPCVLPMYPLISGIVLG GRQRLSTGRALLLAFIYVQGMALTYTALGLVVAAAGLQFQAALQHPYVLIGLAIVFTLLA LSMFGLFTLQLPSSLQTRLTLMSNRQQGGSPGGVFVMGAIAGLICSPCTTAPLSAILLYI AQSGNMWLGGGTLYLYALGMGLPLMLVTVFGNRLLPKSGPWMAHVKTAFGFVILALPVFL LERIIGEAWGLRLWSLLGVAFFGWAFITSLQARRAWMRIVQIILLAAALISVRPLQDWAF GSPSAQAPAHLNFTAISTVDELNQALAQAKGKPVMLDFYADWCVACKEFEKYTFSDPRVQ QVLGDTVLLQANVTANNAQDVALLKHLQVLGLPTILFFDAQGQEQPQARVTGFMDAATFS AHLHDRQP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dsbD |
Synonyms | dsbD; STY4682; t4374; Thiol:disulfide interchange protein DsbD; Protein-disulfide reductase; Disulfide reductase |
UniProt ID | Q8Z1A8 |
◆ Recombinant Proteins | ||
LDH-72P | Recombinant Pv LDH Protein | +Inquiry |
RFL23293ZF | Recombinant Full Length Zymomonas Mobilis Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged | +Inquiry |
MCPH1-9647M | Recombinant Mouse MCPH1 Protein | +Inquiry |
Spry1-1801M | Recombinant Mouse Spry1 protein, His & T7-tagged | +Inquiry |
SIRT5-720Z | Recombinant Zebrafish SIRT5 | +Inquiry |
◆ Native Proteins | ||
GlycoProtein G-11H | Native HSV-2 GlycoProtein G | +Inquiry |
Alb-109R | Native Rat Albumin | +Inquiry |
ALPP-8005H | Native Human Placental Alkaline Phosphatase | +Inquiry |
FGF2-26551TH | Native Human FGF2 | +Inquiry |
PROC-273B | Active Native Bovine Protein C - DEGR (active site blocked) | +Inquiry |
◆ Cell & Tissue Lysates | ||
Seminal-625R | Rat Seminal Vesicles Lysate, Total Protein | +Inquiry |
PLIN2-3107HCL | Recombinant Human PLIN2 293 Cell Lysate | +Inquiry |
C11orf65-76HCL | Recombinant Human C11orf65 lysate | +Inquiry |
C19orf48-8205HCL | Recombinant Human C19orf48 293 Cell Lysate | +Inquiry |
PER3-1333HCL | Recombinant Human PER3 cell lysate | +Inquiry |
See All Seminal Vesicles Total Protein Cell & Tissue Lysates |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All dsbD Products
Required fields are marked with *
My Review for All dsbD Products
Required fields are marked with *
0
Inquiry Basket