Recombinant Full Length Thiobacillus Denitrificans Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL25657TF |
Product Overview : | Recombinant Full Length Thiobacillus denitrificans Membrane protein insertase YidC(yidC) Protein (Q3SF38) (1-546aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Thiobacillus denitrificans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-546) |
Form : | Lyophilized powder |
AA Sequence : | MDNQRLILFIVFSFSLLLLWEAWQDKQAPAPATRPVAGAPAGSAAPTPSTALNAPAAAPA QTGFAKGARAVVETDVLRATIDANGGDLRELQLLGYRETEDKNRVFTLFEDSRTRPYLAQ SGFVGGGLPTHRSTFELTPGTYRLTGGAARLEVPLVWNDAARGVRVEKTFIFTRGSHEVA VRTRVVNRGKEPLDLTPYYQFTRHGEAPRGESFFLYTYTGPAFYTDAKKFQKVPFTDIQD GSAEFEKTATNGWVGLVQHHFVAAWLPEESVKREYYARSLGEGLYSAGVILAEGQLAPGQ QKTFTVPLYAGPQSQAVLEKAAPGLDLARDYGWLTPLAYPIFWSLEKIERLVGNWGWAII ILTILIKLALYPLSAAGYKSMAKMKKLTPRLQQLKETYGDDRAKLHQAMAEMYKTEKINP LGGCLPILIQIPVFIALYWVLLAAVEMRGAPWLGWITDLTAPDPWYILPIIMGVTSILQV KLNPQPMDPMQAKIMMIMPVAFTVMFVFFPAGLVLYWVVNNILSIAQQWAINKQVEGSGK PAPAKT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; Tbd_2825; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | Q3SF38 |
◆ Native Proteins | ||
Brain-013H | Human Brain Lysate, Total Protein | +Inquiry |
LDH1-18H | Native Human Lactate Dehydrogenase 1 | +Inquiry |
KNG1-29338TH | Native Human KNG1 | +Inquiry |
INS-512D | Native Bovine INS | +Inquiry |
Proteasome 26S-38H | Native Human Proteasome 26S Protein, Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM176B-6403HCL | Recombinant Human FAM176B 293 Cell Lysate | +Inquiry |
LYRM5-4583HCL | Recombinant Human LYRM5 293 Cell Lysate | +Inquiry |
Hippocampus-236H | Human Hippocampus Cytoplasmic Lysate | +Inquiry |
CLEC4D-1006RCL | Recombinant Rat CLEC4D cell lysate | +Inquiry |
ARCN1-8763HCL | Recombinant Human ARCN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket