Recombinant Full Length Thermotoga Maritima Upf0118 Membrane Protein Tm_1349(Tm_1349) Protein, His-Tagged
Cat.No. : | RFL24695TF |
Product Overview : | Recombinant Full Length Thermotoga maritima UPF0118 membrane protein TM_1349(TM_1349) Protein (Q9X170) (1-338aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Thermotoga maritima |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-338) |
Form : | Lyophilized powder |
AA Sequence : | MKEFRKILEDKAFFFTTLYILISFLVFKIFPDVFAVIVLMVFFTLLLDPVIRFLEKLKFG KYFSRVAALLLFFFVMVYSLYMIIPPVFNEFGSFIEFMTKVFESKIWKDYIKSPELMPVF DKIMNFLEPKLTDFLNYVFSLVTTNFVSVTTIIVFTLFGLGYTVFYIREIASFFVLIYPK SVRAEAREFFRDVYASMGRYIRVIFINAVIIGLSYWIVFEAFNLKYSAIISLWAFVTNFI PIVGVVLEYIPVLLFSLTLGVKGVLLIALFAILIHAVAFVVFIQLMKGLEKLNPVYIILS ILFFGKLFGLFGSFVGVPLALFFKVFWRKFLRPLFEAG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TM_1349 |
Synonyms | TM_1349; Putative transport protein TM_1349 |
UniProt ID | Q9X170 |
◆ Native Proteins | ||
LTA-18S | Native S. aureus LTA Protein | +Inquiry |
BPI-182H | Native Human Bacterial/Permeability-Increasing Protein | +Inquiry |
APOB-216H | Native Human APOB Protein | +Inquiry |
S100A9-3179H | Native Human S100A9 protein(Met1-Pro114) | +Inquiry |
TF-136C | Native Chicken Ovotransferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
Skin-144R | Rat Skin Tissue Lysate | +Inquiry |
DPAGT1-6840HCL | Recombinant Human DPAGT1 293 Cell Lysate | +Inquiry |
ELL2-6625HCL | Recombinant Human ELL2 293 Cell Lysate | +Inquiry |
UBE2I-574HCL | Recombinant Human UBE2I 293 Cell Lysate | +Inquiry |
IKZF1-850HCL | Recombinant Human IKZF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TM_1349 Products
Required fields are marked with *
My Review for All TM_1349 Products
Required fields are marked with *
0
Inquiry Basket