Recombinant Full Length Thermotoga Maritima Undecaprenyl-Diphosphatase(Uppp) Protein, His-Tagged
Cat.No. : | RFL7501TF |
Product Overview : | Recombinant Full Length Thermotoga maritima Undecaprenyl-diphosphatase(uppP) Protein (Q9WZZ5) (1-237aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Thermotoga maritima |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-237) |
Form : | Lyophilized powder |
AA Sequence : | MDLLLGIVQGLTEFLPISSSGHLTLLSHLLKTDLNAYQTAVLHLGTLVSVVLFALDGIRR SLRSWRIILNLIVSTIPAGVFGVLFEKQIDQLFSSPRFLPLFFSATALILMFTRYSSSGE KRMENMSFLDALLVGIAQLFALFPGISRSGITVSSLLFMKYRSEDALQYSFLMSIPVVLG AGILGLGKGNVTILAPIFAFLSGLFALYVLSRSVRSGKIWQFSYYCLFVAILSYLAG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | uppP |
Synonyms | uppP; bacA; upk; TM_0893; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase |
UniProt ID | Q9WZZ5 |
◆ Native Proteins | ||
F2-303R | Native Rat Thrombin | +Inquiry |
Complement C3b-47H | Native Human Complement C3b | +Inquiry |
Alb-7992M | Native Mouse Serum Albumin | +Inquiry |
ALB-4783D | Native Dog Albumin | +Inquiry |
Gliadin-168W | Native Wheat Gliadin | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM163A-6415HCL | Recombinant Human FAM163A 293 Cell Lysate | +Inquiry |
ARL16-8717HCL | Recombinant Human ARL16 293 Cell Lysate | +Inquiry |
MAGED2-4538HCL | Recombinant Human MAGED2 293 Cell Lysate | +Inquiry |
MARCH8-4467HCL | Recombinant Human MARCH8 293 Cell Lysate | +Inquiry |
MET-001CCL | Recombinant Cynomolgus MET cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All uppP Products
Required fields are marked with *
My Review for All uppP Products
Required fields are marked with *
0
Inquiry Basket