Recombinant Full Length Thermotoga Maritima Uncharacterized Abc Transporter Atp-Binding Protein Tm_0288(Tm_0288) Protein, His-Tagged
Cat.No. : | RFL3946TF |
Product Overview : | Recombinant Full Length Thermotoga maritima Uncharacterized ABC transporter ATP-binding protein TM_0288(TM_0288) Protein (Q9WYC4) (1-598aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Thermotoga maritima |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-598) |
Form : | Lyophilized powder |
AA Sequence : | MPEIRRRPHGPILEKPALKNPTATLRRLLGYLRPHTFTLIMVFVFVTVSSILGVLSPYLI GKTIDVVFVPRRFDLLPRYMLILGTIYALTSLLFWLQGKIMLTLSQDVVFRLRKELFEKL QRVPVGFFDRTPHGDIISRVINDVDNINNVLGNSIIQFFSGIVTLAGAVIMMFRVNVILS LVTLSIVPLTVLITQIVSSQTRKYFYENQRVLGQLNGIIEEDISGLTVIKLFTREEKEME KFDRVNESLRKVGTKAQIFSGVLPPLMNMVNNLGFALISGFGGWLALKDIITVGTIATFI GYSRQFTRPLNELSNQFNMIQMALASAERIFEILDLEEEKDDPDAVELREVRGEIEFKNV WFSYDKKKPVLKDITFHIKPGQKVALVGPTGSGKTTIVNLLMRFYDVDRGQILVDGIDIR KIKRSSLRSSIGIVLQDTILFSTTVKENLKYGNPGATDEEIKEAAKLTHSDHFIKHLPEG YETVLTDNGEDLSQGQRQLLAITRAFLANPKILILDEATSNVDTKTEKSIQAAMWKLMEG KTSIIIAHRLNTIKNADLIIVLRDGEIVEMGKHDELIQKRGFYYELFTSQYGLVVEKE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TM_0288 |
Synonyms | TM_0288; Uncharacterized ABC transporter ATP-binding protein TM_0288 |
UniProt ID | Q9WYC4 |
◆ Native Proteins | ||
PALB-134P | Native Pigeon Prealbumin | +Inquiry |
BSI-B4-852 | Active Native Bandeiraea simplicifolia Isolectin B4 protein | +Inquiry |
BGLAP-286B | Native Bovine Osteocalcin | +Inquiry |
Tnni3-7423M | Native Mouse Tnni3 Protein | +Inquiry |
IgG-351C | Native Cat IgG | +Inquiry |
◆ Cell & Tissue Lysates | ||
KHK-4985HCL | Recombinant Human KHK 293 Cell Lysate | +Inquiry |
CBX7-7801HCL | Recombinant Human CBX7 293 Cell Lysate | +Inquiry |
FABP2-6478HCL | Recombinant Human FABP2 293 Cell Lysate | +Inquiry |
A4GNT-9162HCL | Recombinant Human A4GNT 293 Cell Lysate | +Inquiry |
SOD3-1573HCL | Recombinant Human SOD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TM_0288 Products
Required fields are marked with *
My Review for All TM_0288 Products
Required fields are marked with *
0
Inquiry Basket