Recombinant Full Length Thermotoga Maritima Methyl-Accepting Chemotaxis Protein 4(Mcp4) Protein, His-Tagged
Cat.No. : | RFL30943TF |
Product Overview : | Recombinant Full Length Thermotoga maritima Methyl-accepting chemotaxis protein 4(mcp4) Protein (Q9X1E2) (1-566aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Thermotoga maritima |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-566) |
Form : | Lyophilized powder |
AA Sequence : | MRSIASKVLVIGVVVVLAFFVTQYVLLNTTVFNSIMERKKEEAKHLVESVYGILERAYEM EQKGELTREQAQELAKSLIGKIRYDDNNYFWINDTHPRMVFHPIKPEMNGQDLSNYKDPN GVYLFNEMVKVAKEKGEGFVSYSWPKAGSDKPEPKISYVKLFEPWGWIVGTGIYVDDVKV TVGNLIFRNVLTVSVIGIAVIIMIFFYGRVLSRKTKAVLSALEKISSGDLSVSVDIKSKD EFGLIAQKLNETVGNLRKMVQEIDKSQDEVERVSEELFALSQQLRSALEEIARASDTISK EVQNASASIEEVTSGSEEVSANSQNISKLIQEISENADNIADFARNGQRVLEEAVKKVED VSENSRETADVVSNVTESARNIEEIVRTIQSIAEQTNLLALNAAIEAARAGEAGRGFAVV ADEIRKLAEESQKATEEISQILENIREGVERTNEMSKKNVEITKDARRLVEESYESFNQI VTRIEDLAARIEGIAASAQELSAASEEMSSALDAVAKTTTTVADEVEEVSENITEQEKAA KRIADIGTELKKLSDELKEDVERFKI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mcp4 |
Synonyms | mcp4; TM_1428; Methyl-accepting chemotaxis protein 4 |
UniProt ID | Q9X1E2 |
◆ Recombinant Proteins | ||
WFS1-6412H | Recombinant Human WFS1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CCL1-30H | Recombinant Human CCL1(Lys24-Lys96) Protein, None-tagged | +Inquiry |
JPH4-376H | Recombinant Human JPH4 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
AGAP9-538H | Recombinant Human AGAP9 Protein, His-tagged | +Inquiry |
K48UB5-319H | Recombinant Human K48UB5 Protein | +Inquiry |
◆ Native Proteins | ||
SERPINA3-8008H | Native Human Serum Alpha 1-AntiChymoTrypsin | +Inquiry |
Collagen-326H | Native Human Collagen Type III | +Inquiry |
SERPINF2-27145TH | Native Human SERPINF2 | +Inquiry |
CSH1-31024TH | Native Human CSH1 | +Inquiry |
Myosin S1-879R | Native Rabbit Myosin S1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCAKD-444HCL | Recombinant Human DCAKD cell lysate | +Inquiry |
HIST1H1E-5551HCL | Recombinant Human HIST1H1E 293 Cell Lysate | +Inquiry |
RBM12B-1482HCL | Recombinant Human RBM12B cell lysate | +Inquiry |
PWP2-2655HCL | Recombinant Human PWP2 293 Cell Lysate | +Inquiry |
USP36-460HCL | Recombinant Human USP36 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All mcp4 Products
Required fields are marked with *
My Review for All mcp4 Products
Required fields are marked with *
0
Inquiry Basket