Recombinant Full Length Teredinibacter Turnerae Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL22241TF |
Product Overview : | Recombinant Full Length Teredinibacter turnerae Membrane protein insertase YidC(yidC) Protein (C5BKL7) (1-560aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Teredinibacter turnerae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-560) |
Form : | Lyophilized powder |
AA Sequence : | MNLLRNALIGGIVLVSFLLIIRWNEFQERKFEETQLQQSSANNSERVAPSIPSEQPQAPN GEEVPDAPASDSKDAVEFTANADNDRQIHISTDTLDLVIDTNGGDIVRLALPQYYAMLHE KDNPFVLLNNNDTSTYIAQSGLVGPNGTDGKNGRPRFSAASSDYTLEPGKDTLVVDLKYQ QESAIITKRFTFHRDSYLIDLEYLIENTGDTNWVGNLYGQIKRDDHNPAQAVGVGMQPFL GAAITTPETNYKKLKFDELAKEKLEVSNTGGWVAMVQHYFMSAWVPDQDKDQKYVLRKSR NANMYFLSFTTLTSTTVAPGTTGSIKAQYYAGPKHIRVLEKIAPHLDLTIDYSWLWFIAK PLFYALDFIHGLVGNWGLAIILLTCCIKLVFFYPSAMSYRSMAKMRKVQPLMNELKERYG DDRQRMSAELMKLYKKEKVNPLGGCLPILLQMPVFIALYWMIMESVELRHAPFFLWIHDL SVRDPYFVLPLIMGVTMWIQQKLNPTPADPMQAKVMQLMPFFFTALFMMFPAGLVLYWVV NNTLSITQQYIITRQIEKAD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; TERTU_4739; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | C5BKL7 |
◆ Recombinant Proteins | ||
UTS2A-12110Z | Recombinant Zebrafish UTS2A | +Inquiry |
GPR173-1948R | Recombinant Rhesus monkey GPR173 Protein, His-tagged | +Inquiry |
RFL13049BF | Recombinant Full Length Brucella Suis Glycerol-3-Phosphate Acyltransferase(Plsy) Protein, His-Tagged | +Inquiry |
MTM1-3471R | Recombinant Rat MTM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PSENEN-3463R | Recombinant Rhesus Macaque PSENEN Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
F2-277B | Active Native Bovine α-Thrombin-BFPRck (Biotin) | +Inquiry |
IGHE -22H | Native Human IgE | +Inquiry |
SNCA-27345TH | Native Human SNCA | +Inquiry |
MB-238E | Native Horse Myoglobin | +Inquiry |
GG-183H | Native Human Gamma Globulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
OSBPL5-3533HCL | Recombinant Human OSBPL5 293 Cell Lysate | +Inquiry |
ZBTB32-743HCL | Recombinant Human ZBTB32 lysate | +Inquiry |
HNRNPH2-5445HCL | Recombinant Human HNRNPH2 293 Cell Lysate | +Inquiry |
ACHN-029WCY | Human Kidney Renal Cell Adenocarcinoma ACHN Whole Cell Lysate | +Inquiry |
LCN2-2781MCL | Recombinant Mouse LCN2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket