Recombinant Full Length Taxus Cuspidata Taxadiene 5-Alpha Hydroxylase Protein, His-Tagged
Cat.No. : | RFL14735TF |
Product Overview : | Recombinant Full Length Taxus cuspidata Taxadiene 5-alpha hydroxylase Protein (Q6WG30) (1-499aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Taxus cuspidata (Japanese yew) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-499) |
Form : | Lyophilized powder |
AA Sequence : | MDALYKSTVAKFNEVTQLDCSTESFSIALSAIAGILLLLLLFRSKRHSSLKLPPGKLGIP FIGESFIFLRALRSNSLEQFFDERVKKFGLVFKTSLIGHPTVVLCGPAGNRLILSNEEKL VQMSWPAQFMKLMGENSVATRRGEDHIVMRSALAGFFGPGALQSYIGKMNTEIQSHINEK WKGKDEVNVLPLVRELVFNISAILFFNIYDKQEQDRLHKLLETILVGSFALPIDLPGFGF HRALQGRAKLNKIMLSLIKKRKEDLQSGSATATQDLLSVLLTFRDDKGTPLTNDEILDNF SSLLHASYDTTTSPMALIFKLLSSNPECYQKVVQEQLEILSNKEEGEEITWKDLKAMKYT WQVAQETLRMFPPVFGTFRKAITDIQYDGYTIPKGWKLLWTTYSTHPKDLYFNEPEKFMP SRFDQEGKHVAPYTFLPFGGGQRSCVGWEFSKMEILLFVHHFVKTFSSYTPVDPDEKISG DPLPPLPSKGFSIKLFPRP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Taxus cuspidata Taxadiene 5-alpha hydroxylase |
Synonyms | Taxadiene 5-alpha hydroxylase |
UniProt ID | Q6WG30 |
◆ Recombinant Proteins | ||
LPL-1389C | Recombinant Chinese hamster LPL protein, His-tagged | +Inquiry |
NDUFS1-1656C | Recombinant Chicken NDUFS1 | +Inquiry |
FKBP3-3024H | Recombinant Human FKBP3 Protein (Met1-Asp224), N-His tagged | +Inquiry |
RFL6723PF | Recombinant Full Length Prochlorococcus Marinus Apocytochrome F(Peta) Protein, His-Tagged | +Inquiry |
UBA5-6387R | Recombinant Rat UBA5 Protein | +Inquiry |
◆ Native Proteins | ||
Lecithin-10S | Native Soy Lecithin | +Inquiry |
ACE-3047R | Native rabbit ACE | +Inquiry |
pepsin -173P | Native Pig pepsin | +Inquiry |
Pectin-008A | Native Apple or Citrus fruits Pectin | +Inquiry |
CKMB-12H | Active Native Human Creatine Kinase MB protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
C4orf29-8031HCL | Recombinant Human C4orf29 293 Cell Lysate | +Inquiry |
NEDD9-1182HCL | Recombinant Human NEDD9 cell lysate | +Inquiry |
PTX3-2102HCL | Recombinant Human PTX3 cell lysate | +Inquiry |
MPRIP-4225HCL | Recombinant Human MPRIP 293 Cell Lysate | +Inquiry |
PTPDC1-2691HCL | Recombinant Human PTPDC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Taxus cuspidata Taxadiene 5-alpha hydroxylase Products
Required fields are marked with *
My Review for All Taxus cuspidata Taxadiene 5-alpha hydroxylase Products
Required fields are marked with *
0
Inquiry Basket