Recombinant Full Length Takifugu Rubripes D(5)-Like Dopamine Receptor Protein, His-Tagged
Cat.No. : | RFL30032TF |
Product Overview : | Recombinant Full Length Takifugu rubripes D(5)-like dopamine receptor Protein (P53454) (1-463aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Takifugu rubripes (Japanese pufferfish) (Fugu rubripes) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-463) |
Form : | Lyophilized powder |
AA Sequence : | MENFYNETEPTEPRGGVDPLRVVTAAEDVPAPVGGVSVRALTGCVLCALIVSTLLGNTLV CAAVIKFRHLRSKVTNAFVVSLAVSDLFVAVLVMPWRAVSEVAGVWLFGRFCDTWVAFDI MCSTASILNLCVISMDRYWAISNPFRYERRMTRRFAFLMIAVAWTLSVLISFIPVQLNWH RADNNSSAHEQGDCNASLNRTYAISSSLISFYIPVLIMVGTYTRIFRIAQTQIRRISSLE RAAGQRAQNQSHRASTHDESALKTSFKRETKVLKTLSVIMGVFVFCWLPFFVLNCVVPFC DVDKVGEPPCVSDTTFNIFVWFGWANSSLNPVIYAFNADFRKAFTTILGCSKFCSSSAVQ AVDFSNELVSYHHDTTLQKEPVPGPGAHRLVAPLPQNRGDAGPNFDKVSVVSDDSRADRN LLLPAILQCDCEAEISLDMVPFGSSGPADSFLIPGQIQDLGDL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dl |
Synonyms | dl; D(5-like dopamine receptor |
UniProt ID | P53454 |
◆ Recombinant Proteins | ||
LIPM-9134M | Recombinant Mouse LIPM Protein | +Inquiry |
FIBIN-3256M | Recombinant Mouse FIBIN Protein, His (Fc)-Avi-tagged | +Inquiry |
LEPRE1-2498R | Recombinant Rhesus monkey LEPRE1 Protein, His-tagged | +Inquiry |
IL5-012F | Recombinant Ferret IL5 Protein, Met1-Ser132, C-His tagged | +Inquiry |
UGT2B20-1079C | Recombinant Cynomolgus UGT2B20 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
FGF1-33B | Active Native Bovine FGF1 | +Inquiry |
ALB-128C | Native Canine Serum Albumin | +Inquiry |
Lectin-1796L | Active Native Lotus Tetragonolobus Lectin Protein, Agarose bound | +Inquiry |
F9-5405M | Native Mouse Coagulation Factor IX | +Inquiry |
AGP-001B | Native Bovine AGP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL22-5232HCL | Recombinant Human IL22 293 Cell Lysate | +Inquiry |
PSMD3-2749HCL | Recombinant Human PSMD3 293 Cell Lysate | +Inquiry |
PAK1-1275HCL | Recombinant Human PAK1 cell lysate | +Inquiry |
NFASC-918HCL | Recombinant Human NFASC cell lysate | +Inquiry |
SGTA-1882HCL | Recombinant Human SGTA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All dl Products
Required fields are marked with *
My Review for All dl Products
Required fields are marked with *
0
Inquiry Basket