Recombinant Full Length Takifugu Rubripes Cannabinoid Receptor Type 1A(Cnr1A) Protein, His-Tagged
Cat.No. : | RFL19840TF |
Product Overview : | Recombinant Full Length Takifugu rubripes Cannabinoid receptor type 1A(cnr1a) Protein (Q98894) (1-468aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Takifugu rubripes (Japanese pufferfish) (Fugu rubripes) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-468) |
Form : | Lyophilized powder |
AA Sequence : | MKSVLDGVADTTFRTITSGLQYLGSNDANYDDPLNDAAFKTGFSLQKPLSAFRSNSFPNK VPADEELIFKGIPFFPTNSTDLFGNRNTTRDENSIQCGENFMDMECFMILTPSQQLAVAV LSLTLGTFTVLENLVVLCVIFQSRTLRCRPSYHFIGSLAVADLLGSVIFVYSFLDFHVFH KKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYRRIVTRTKAVIAFCMMW TISIIIAVLPLLGWNCKRLNSVCSDIFPLIDENYLMFWIGVTSVLVLFIIYAYIYILWKA HHHAVRMLSRTSQKSLVVYSAEGTKVQTTRPEQTRMDIRLAKTLVLILAVLVICWGPLLA IMVYDLFWKMDDNIKTVFAFCSMLCLLNSTVNPIIYALRSRDLRHAFLSSCHACRGSAQQ LDNSLESDCQNRNVNISANRAAESCVKTTVKIAKVTMSVSTETSAEAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cnr1a |
Synonyms | cnr1a; cb1a; Cannabinoid receptor type 1A |
UniProt ID | Q98894 |
◆ Recombinant Proteins | ||
AYP1020-RS07030-4885S | Recombinant Staphylococcus capitis subsp. capitis (strain: AYP1020, sub-species: capitis) AYP1020_RS07030 protein, His-tagged | +Inquiry |
RFL26492XF | Recombinant Full Length Xenopus Laevis 2-Acylglycerol O-Acyltransferase 2-A(Mogat2-A) Protein, His-Tagged | +Inquiry |
C19orf50-10441H | Recombinant Human C19orf50, His-tagged | +Inquiry |
STMN3-16155M | Recombinant Mouse STMN3 Protein | +Inquiry |
AEN-396H | Recombinant Human AEN Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Heart-005H | Human Heart Lysate, Total Protein | +Inquiry |
Fibrin-001H | Native Human Fibrin Protein | +Inquiry |
Pla2-85A | Active Native Apis mellifera Phospholipase A2 | +Inquiry |
Prothrombin-59H | Native Human Prothrombin Frag 1 | +Inquiry |
C6-55H | Native Human Complement C6 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITIH1-882HCL | Recombinant Human ITIH1 cell lysate | +Inquiry |
PPP6R2-1560HCL | Recombinant Human PPP6R2 cell lysate | +Inquiry |
KCNIP4-5050HCL | Recombinant Human KCNIP4 293 Cell Lysate | +Inquiry |
SOX1-1566HCL | Recombinant Human SOX1 293 Cell Lysate | +Inquiry |
ERBB2-2010RCL | Recombinant Rat ERBB2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cnr1a Products
Required fields are marked with *
My Review for All cnr1a Products
Required fields are marked with *
0
Inquiry Basket