Recombinant Full Length Syntrophus Aciditrophicus Large-Conductance Mechanosensitive Channel(Mscl) Protein, His-Tagged
Cat.No. : | RFL33118SF |
Product Overview : | Recombinant Full Length Syntrophus aciditrophicus Large-conductance mechanosensitive channel(mscL) Protein (Q2LUI9) (1-152aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Syntrophus aciditrophicus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-152) |
Form : | Lyophilized powder |
AA Sequence : | MFKEFKEFALKGNVVDMAVGIILGVAFGAIVKSLVDDLLMPGIGILLGSADFSNLFLVIK EGATPGPFTTLADAQKAGAVTINYGLFINTIVNFIIVAFALFLVIRNINQLRRMTEKPPV EEAPTTKDCPYCLSAIPLKATRCPNCTSELKG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mscL |
Synonyms | mscL; SYNAS_18670; SYN_01974; Large-conductance mechanosensitive channel |
UniProt ID | Q2LUI9 |
◆ Native Proteins | ||
Lectin-1783G | Native Griffonia Simplicifolia Lectin I isolectin B4 Protein, DyLight 594 Labeled | +Inquiry |
S100B-257B | Native Bovine S-100b Protein | +Inquiry |
CRP-158R | Native Rabbit C-Reactive Protein | +Inquiry |
Lectin-1789G | Active Native Griffonia Simplicifolia Lectin II Protein, Fluorescein labeled | +Inquiry |
PLG-55H | Native Human lys-Plasminogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
TLR10-1046HCL | Recombinant Human TLR10 293 Cell Lysate | +Inquiry |
TP53I13-858HCL | Recombinant Human TP53I13 293 Cell Lysate | +Inquiry |
CHID1-7536HCL | Recombinant Human CHID1 293 Cell Lysate | +Inquiry |
CYP2A7-7115HCL | Recombinant Human CYP2A7 293 Cell Lysate | +Inquiry |
ENTPD7-6590HCL | Recombinant Human ENTPD7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mscL Products
Required fields are marked with *
My Review for All mscL Products
Required fields are marked with *
0
Inquiry Basket