Recombinant Full Length Synechocystis Sp. Upf0053 Protein Sll1254 (Sll1254) Protein, His-Tagged
Cat.No. : | RFL36527SF |
Product Overview : | Recombinant Full Length Synechocystis sp. UPF0053 protein sll1254 (sll1254) Protein (P74078) (1-346aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Synechococcus sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-346) |
Form : | Lyophilized powder |
AA Sequence : | MLEIVAAIFIVLLGSGICSCAEAALFSVPLVKVRQLSQSNNPSAIALQAIRHRMNRPIGT IVVLNNIFNIVGSITIGALATKHLQDAWMGVFSGILTLLIIVFGEIIPKTLGERYATNIA LLIAIPVRFLTLIFTPLVWLIEQITNPFTHGKRVPSTNEAEIKFLATLGYKEGVIEGDEE QMIQRVFQLNDLMAVDLMTPRVIITYLLGELTLAECQQDIIQSQHTRILIVDEYIDEVLG IALKQDLLTALIQGEGYKTIAELARPAQFVPEGMRADKLLKQFQEKREHLMVVIDEYGGV AGVITLEDVVEVLTGEIVDETDKNIDLQEIARKKRQALLKQRGVAP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | sll1254 |
Synonyms | sll1254; UPF0053 protein sll1254 |
UniProt ID | P74078 |
◆ Recombinant Proteins | ||
TNFRSF4-548RAF488 | Recombinant Monkey TNFRSF4 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
UBE2D1-0040H | Recombinant Human UBE2D1 Protein (A2-M147), Tag Free | +Inquiry |
CYC1-2390HF | Recombinant Full Length Human CYC1 Protein, GST-tagged | +Inquiry |
CC2D1A-822R | Recombinant Rat CC2D1A Protein, His (Fc)-Avi-tagged | +Inquiry |
BRCA2-6856H | Recombinant Human BRCA2 protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
C4BPA-100H | Native Human C4a Anaphylatoxin (Not Recombinant) | +Inquiry |
Bone Marrow-007H | Human Bone Marrow Lysate, Total Protein | +Inquiry |
IgG-170G | Native Goat IgG Fc fragment | +Inquiry |
V8Protease-01S | Active Native Staph aureus V8 Protease, Tag Free | +Inquiry |
TroponinCIT-33HFL | Native Full Length Human Cardiac Troponin C-I-T Complex | +Inquiry |
◆ Cell & Tissue Lysates | ||
MCCC2-4428HCL | Recombinant Human MCCC2 293 Cell Lysate | +Inquiry |
MID2-4318HCL | Recombinant Human MID2 293 Cell Lysate | +Inquiry |
Pancreas-725P | Pig Pancreas Lysate, Total Protein | +Inquiry |
ZFYVE9-172HCL | Recombinant Human ZFYVE9 293 Cell Lysate | +Inquiry |
ST6GALNAC3-1437HCL | Recombinant Human ST6GALNAC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All sll1254 Products
Required fields are marked with *
My Review for All sll1254 Products
Required fields are marked with *
0
Inquiry Basket