Recombinant Full Length Synechocystis Sp. Uncharacterized Protein Slr1875 (Slr1875) Protein, His-Tagged
Cat.No. : | RFL29831SF |
Product Overview : | Recombinant Full Length Synechocystis sp. Uncharacterized protein slr1875 (slr1875) Protein (P73633) (1-212aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Synechococcus sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-212) |
Form : | Lyophilized powder |
AA Sequence : | MARLSQELQDYFFKEDRGPTVNLAQVLAIAKEKIFGIVLVILSLPSALPIPAPGYSTPFG VLIFLVAIQLMAGRQELWLPLSWQSKTIKTSKAQGIVKAGLPWLKRLEAIAHPRFPLVCQ SRLGKILMGITVGSMAISMMIPIPGTNTLPAMSIFITGFGLQEDDGLITGAGMIFSVLIG VLMVSVIYVFFNGGITIIDILKDWLKVQFGGA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | slr1875 |
Synonyms | slr1875; Uncharacterized protein slr1875 |
UniProt ID | P73633 |
◆ Native Proteins | ||
RBP-94H | Native Human Retinol-Binding Protein | +Inquiry |
ATF-181R | Native Rat Apotransferrin | +Inquiry |
RNASE2-171H | Native Human Eosinophil Derived Neurotoxin | +Inquiry |
Complement C4-50H | Native Human Complement C4 | +Inquiry |
SAA-95H | Native Human Serum amyloid A | +Inquiry |
◆ Cell & Tissue Lysates | ||
NEK3-446MCL | Recombinant Mouse NEK3 cell lysate | +Inquiry |
SET-1928HCL | Recombinant Human SET 293 Cell Lysate | +Inquiry |
VN1R1-401HCL | Recombinant Human VN1R1 293 Cell Lysate | +Inquiry |
SMR3B-001HCL | Recombinant Human SMR3B cell lysate | +Inquiry |
BRAF-8414HCL | Recombinant Human BRAF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All slr1875 Products
Required fields are marked with *
My Review for All slr1875 Products
Required fields are marked with *
0
Inquiry Basket